KEGG   Neokomagataea sp. Ha5: E3E11_04285Help
Entry
E3E11_04285       CDS       T06092                                 

Gene name
rfaD
Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
neh  Neokomagataea sp. Ha5
Pathway
neh00540  Lipopolysaccharide biosynthesis
neh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:neh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    E3E11_04285 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:neh01005]
    E3E11_04285 (rfaD)
Enzymes [BR:neh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     E3E11_04285 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:neh01005]
 Unusual sugar
  E3E11_04285 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: QDH15201
Position
983686..984780
Genome map
AA seq 364 aa AA seqDB search
MMIVTGGAGFIGSCLQAALFRRGEDTVVVDHLGQQGKWRNLAAHPPSEIVSPQALEGFLE
TLRAHGRKPRALLHLGAISATTACDGDLVWQTNVALSQRLWQWCAQMEVPFIYASSAATY
GNGACGAANPAGHETAEEAGEGGPTAFQDGLAGVPGLRPLNLYGWSKQAFDLWVRTTLER
GDPSPPQWAGLKFFNVYGPNEYHKQEMVSVVKVKYDEVRAGRPVTLFRSDGAGLADGHQR
RDFIWVGDAVRVMLWLLDHPQVSGLFNCGTGAARTYLDLARLTCRAAGRPEDIAFVPMPE
KLQGQYQSYTCADLTRLRAAGYTAPFTSLEDGISMYVEQFLMRGSQACLDDPSQGAARWA
GGYL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcgtcaccggcggggccggatttataggctcatgtctgcaggcagccctgttc
cggcgtggcgaggacacggtcgtggtggaccatctgggccagcagggcaagtggcgcaat
ctggcagcccatcccccctctgaaatcgtcagtccgcaggcgctggaaggttttcttgaa
acactgcgcgcgcacggccggaaaccgcgtgcgctcctgcatctgggcgcgatcagcgcc
actacggcttgtgacggggacctggtctggcagaccaacgtggctctctcgcagcggctc
tggcagtggtgtgcgcagatggaggtgccctttatctatgcgtcttctgccgcgacttac
ggcaatggcgcttgcggtgcagccaaccctgctggccatgaaactgccgaggaagcaggt
gaaggcggcccaaccgcgtttcaggacggtcttgccggcgtgcccggcctgcgcccgctc
aatctgtatggctggtccaaacaggcctttgatctgtgggtcagaacaaccctggaacgt
ggggacccgtcaccgccgcaatgggcggggctgaagtttttcaatgtctacggtcccaat
gaataccacaagcaagagatggtctcggtggtgaaggtcaaatatgatgaagtccgggcg
ggccggccggtgacgcttttccgctctgacggggccggtctggccgatggccaccagaga
cgtgatttcatctgggtgggagatgcggtgcgcgtcatgctgtggctgctggaccatccg
caggtcagcggtctgttcaactgcggcaccggcgcggcgcggacttatcttgacctggcc
cgtttgacctgtcgggcggcagggcgtcctgaagacatcgctttcgtgccgatgcctgaa
aaactgcaggggcagtatcagtcctacacctgtgcagaccttacacgcctgcgtgccgcc
ggctataccgcccctttcacgagccttgaagacgggatcagcatgtatgtggaacagttt
ctcatgaggggatcgcaggcctgtctggatgacccgtcacagggggccgcgcgctgggca
ggaggttacctgtga

DBGET integrated database retrieval system