KEGG   Neisseria sp. 10023: BG910_01010Help
Entry
BG910_01010       CDS       T05718                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
nei  Neisseria sp. 10023
Pathway
nei00220  Arginine biosynthesis
nei01100  Metabolic pathways
nei01110  Biosynthesis of secondary metabolites
nei01130  Biosynthesis of antibiotics
nei01230  Biosynthesis of amino acids
Module
nei_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:nei00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BG910_01010
Enzymes [BR:nei01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     BG910_01010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: ASK26515
UniProt: A0A220RZW6
Position
complement(220304..221332)
Genome map
AA seq 342 aa AA seqDB search
MNLKNRHFLKLLDFTQDEILHYLQLAAELKAAKKAGNEVQKMKGKNIALIFEKTSTRTRC
AFEVAARDQGAGVTYLEPTGSQIGHKESIKDTARVLGRMYDGIEYRGFGQEVVEELAKYA
GVPVFNGLTNEFHPTQMLADALTMQEHSDKPLNQVAYAYVGDARYNMANSLLILGAKLGM
DVRIGAPKALWPSENIIAQAQAVAAETGAKITLTESAEEAVKGVDFIHTDVWVSMGEPKE
VWQERIDLLKAYRVTPELMAASGNPDVKFMHCLPAFHNRETTVGEWIYETFGLNGVEVTE
EVFESGASIVFDQAENRMHTIKAVMVAALGNKAGALQNQKAV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcaaaaaccgccattttctcaagctcttagattttacccaagacgaaatcctg
cattatctgcaactggccgccgaactcaaagccgccaaaaaagcaggtaatgaagtgcag
aaaatgaaaggcaaaaacatcgccctgatttttgaaaaaacctctacccgcacgcgttgc
gcgtttgaagtggccgcgcgcgatcagggcgcgggcgtaacctatctcgaaccgaccggc
agccaaatcgggcataaggaaagcatcaaagacactgcgcgcgtgttggggcgcatgtac
gacggcatcgaataccgcggcttcgggcaggaagtggtcgaagaactggcgaaatacgca
ggcgtgccggtgttcaacggcctgaccaacgagttccaccccacccagatgctggccgac
gctctgaccatgcaggaacacagcgacaaaccgttgaaccaagtagcctatgcctacgtc
ggcgacgcgcgctacaacatggccaattcgctgctgattttgggcgcaaaactgggcatg
gacgtgcgcatcggtgcgccgaaagccttgtggccgtctgaaaacatcatcgcccaagcg
caggccgtggccgccgaaaccggcgcgaaaatcacgttgaccgaaagcgcggaagaagcg
gtaaaaggcgtggactttatccataccgacgtgtgggtcagcatgggcgagccgaaagaa
gtatggcaggagcgtatcgacttgctcaaggcctaccgcgttacccccgaactgatggcg
gcttcgggcaatcccgacgtgaaattcatgcactgcctgcccgcgtttcacaaccgcgag
actaccgtcggcgaatggatttacgaaaccttcggcttaaacggcgtggaagtgacggaa
gaggtgtttgaaagcggagccagcattgtgttcgaccaggccgaaaaccgtatgcacacg
attaaagcggtgatggtcgcggcgctggggaataaggccggggctttgcaaaatcaaaag
gccgtctga

DBGET integrated database retrieval system