KEGG   Neisseria sp. 10023: BG910_05665Help
Entry
BG910_05665       CDS       T05718                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
nei  Neisseria sp. 10023
Pathway
nei00670  One carbon pool by folate
nei00790  Folate biosynthesis
nei01100  Metabolic pathways
Module
nei_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nei00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BG910_05665
   00670 One carbon pool by folate
    BG910_05665
Enzymes [BR:nei01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BG910_05665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ASK27294
UniProt: A0A220S1F0
Position
1150628..1151122
Genome map
AA seq 164 aa AA seqDB search
MPKITLIAACTADRCIGINNTMPWHLPEDFAFFKAYTLDKPVIMGRKTWESLPKKPLPGR
LNIVISRQPDYPAEGAQTAQTLDAALALCGGAEEIIIMGGAEIYAQALPQATDLRITEVD
LQVAGDAFFPEFSKQDWQEISREAHVSAKGTGFAFVHYRRRGTD
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaatcaccctcatcgccgcctgcaccgccgaccgctgcatcggcatcaacaac
accatgccctggcatctgcccgaagatttcgcctttttcaaagcctacacgctggacaaa
cccgtcatcatggggcgcaaaacctgggaatcgctgccgaaaaaaccgctgcccggccgt
ctgaatatcgtcatcagccgtcagccggactatcccgccgagggcgcgcaaacggcgcaa
acgctggatgcggcgctggctttgtgcggcggcgcggaagaaatcatcatcatgggcggc
gcggaaatctacgcccaagccctgccgcaggcgacggatttgcggattacggaagtggat
ttgcaggttgcgggcgacgcatttttccccgagttttccaaacaggattggcaggaaatc
tcccgcgaggcgcacgtttcggccaagggcacaggttttgcgttcgtccattaccggcgg
cgcgggacggattga

DBGET integrated database retrieval system