KEGG   Neisseria sp. 10023: BG910_06805Help
Entry
BG910_06805       CDS       T05718                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
nei  Neisseria sp. 10023
Brite
KEGG Orthology (KO) [BR:nei00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BG910_06805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Ytca
Motif
Other DBs
NCBI-ProteinID: ASK27492
UniProt: A0A220S241
Position
complement(1375996..1377570)
Genome map
AA seq 524 aa AA seqDB search
MNQAQPGSNLKLINAFFAAMLVGMVGYFIVWGLDYTHSNHAVLFILATMFGVFMAFNVGG
NDIANSFGTSVGSGTLTIPQALLIAAVFEVSGAVIAGGEVTDTIRKGIIDLNAMSLEPMQ
FVYIMMSALLAAALWLLFATKKGLPVSTTHAIIGGIVGSALCLAFMSHVEAGGLIKWGKL
GEIAVSWVLSPVLGGAVSFVVFGLVKKYVLDYNAWADKTLAEIKQERRAYKARHNEFFEG
LDDAGKADYATKLSHDAQIYDEADFDPDELQSDYYRGLYELDVRKEGVDSYRALHSWVPV
IASVGAMMVSSMLIFKGLKNLHLGLSNVNSFLTIFMIGAGVWMGTFVFAKNLKRKDLGKS
TFQMFSWMQVFTACGFAFSHGANDIANAIGPFAAIMDVLRSGNITEQNAVPPVAMLTFGI
ALIVGLWFIGKDVIKTVGSDLAKMHPSSGFSAELSAAAVVMGASLMGLPVSSTHILVGAV
LGIGLVNLDANWSLMKPIGLAWVITLPAAAVLSVACYLVLQAVF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggctcaaccgggatcaaacctgaagctgattaatgcctttttcgccgctatg
cttgtgggcatggtcggctattttatcgtttggggcttggattatacgcatagcaatcat
gccgttttatttattctggcgacgatgttcggcgtgtttatggcgtttaacgtgggcggc
aacgatattgccaactcgttcggaacttccgtcggttcgggtacgctgacgattccgcag
gcgcttttgattgcggcggtgtttgaggtcagcggcgcggtgattgccggtggcgaggta
acggataccatccgcaaagggattatcgatttgaacgcgatgagcctcgagccgatgcag
tttgtctatatcatgatgtcggcgctgttggcggcggcgctgtggctgttgtttgccacc
aaaaaagggctgccggtttcgacgacgcacgcaattatcggcggcatcgtcggcagcgcg
ctgtgtctggcgtttatgagccatgttgaggcgggcggcctgattaaatggggcaaactc
ggcgagattgcggtttcgtgggtgttgtcgccggtattgggcggcgcagtgtcgtttgtc
gtgttcggcctggttaaaaaatatgtgttggactacaacgcctgggcagacaaaacgctg
gccgaaatcaagcaggaacgccgtgcctacaaagcgcgccacaacgaatttttcgagggt
ctcgacgacgccggcaaagccgattacgccaccaaactctcgcacgacgcgcagatttac
gacgaagcggatttcgatcccgacgagctgcaatccgattattaccgtggtctgtatgaa
ttggacgtgcggaaagagggtgtcgactcctaccgcgcgctgcattcgtgggtacctgtg
attgcctcggtcggcgcgatgatggtgtcgtcgatgctgattttcaaaggcctgaaaaac
ctgcatttggggctgagcaacgtcaacagcttcctgaccattttcatgatcggcgcgggc
gtttggatgggaacattcgtgttcgccaaaaacctcaaacgcaaagatttgggcaaatcc
acatttcagatgttcagctggatgcaggtctttaccgcctgcggtttcgccttcagccac
ggcgccaacgacattgccaatgccatcggcccgtttgccgcgattatggacgttttgcgt
tcgggcaacatcaccgagcaaaacgccgttccgcccgtcgccatgctgaccttcggcatc
gccctgattgtcggcctgtggtttatcggcaaggacgtgattaaaaccgtcggctcggat
ttggcaaaaatgcacccctcttccggcttctccgccgagctttccgccgccgccgtcgtg
atgggtgcgtcgctgatgggcttgcccgtgtcgagtacccacatcctcgtcggcgccgtt
ttaggcatcggcctggtcaacctcgacgccaactggtcgctgatgaaacccatcggcctg
gcttgggtgattaccctgcccgccgccgcggtgttgtcggtggcgtgctatctggtgttg
caggctgtgttctga

DBGET integrated database retrieval system