KEGG   Neisseria sp. KEM232: CGZ77_05855Help
Entry
CGZ77_05855       CDS       T05913                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
nek  Neisseria sp. KEM232
Pathway
nek00260  Glycine, serine and threonine metabolism
nek00630  Glyoxylate and dicarboxylate metabolism
nek00670  One carbon pool by folate
nek01100  Metabolic pathways
nek01110  Biosynthesis of secondary metabolites
nek01130  Biosynthesis of antibiotics
nek01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nek00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CGZ77_05855 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CGZ77_05855 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CGZ77_05855 (gcvT)
Enzymes [BR:nek01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     CGZ77_05855 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG POPLD
Motif
Other DBs
NCBI-ProteinID: ASP17308
Position
complement(1187595..1188692)
Genome map
AA seq 365 aa AA seqDB search
MTLNTTPFHQAHIDAGAKLIDFAGWELPIHYGSQIAEHEAVRTDAGMFDVSHMLVTDVAG
ANAKAFFRKLIANDVAKLAFVGKALYSAMLNDKGGVIDDLIVYRTNEAETQYRIVSNGAT
REKDTAQFHKIGAEFGVAFNPRYDLGMLAVQGPKAVEKLLTVKTEWADVVNNLKPFQGAD
LGNDWFVARTGYTGEDGVEVILPGSEATAFFKALEAAGVKPCGLGARDTLRMEAGMNLYG
NDMDDDVSPLEAGMGWTVDLKDEARDFVGKAALLALKEKGVAVKQVGLLLAKGGVLRDHM
EVVTDAGRGITTSGVFSPSLKQSIAIARVPKDFDGDAAKVVIRGKEADVRVLKLPFVRNG
QKQFD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgaacaccacgccttttcatcaagcccatatcgacgcgggcgcaaaactcatc
gactttgccggctgggagctgcccatccactacggctcgcaaatcgccgaacacgaagcc
gtgcgtaccgacgcgggtatgttcgacgtatcgcatatgctggttaccgacgtggccggt
gccaacgccaaagcctttttccgcaaactgattgccaacgacgtggccaagctcgccttc
gtcggcaaagccctctactccgccatgctcaacgacaaaggcggcgtgattgacgactta
atcgtataccgcaccaacgaagccgaaacccaataccgcatcgtctccaacggcgcgacg
cgcgaaaaagacaccgcccagttccacaaaatcggcgcggaattcggcgtggcgttcaac
ccgcgctatgacttgggtatgctcgccgtgcaaggcccaaaagcggttgaaaaactcctg
accgtcaaaaccgaatgggcggacgtggtgaacaatctcaaacccttccaaggcgcggat
ttgggcaacgactggtttgtcgcccgcaccggctacaccggcgaagacggcgtggaagtc
atcctgcctggcagcgaagccaccgcgtttttcaaagccctcgaagcggcaggcgtgaaa
ccctgcggcctcggcgcgcgcgacaccctgcgtatggaagcgggcatgaacctctacggc
aacgatatggacgacgacgtgagcccgctggaagccggcatgggctggacggtggatttg
aaagacgaagcgcgcgatttcgtcggcaaagccgcgctccttgccctgaaagaaaaaggc
gtagccgtaaaacaggtcggtctgctgctcgccaaaggcggcgtgttgcgcgaccatatg
gaagtggtaaccgacgcagggcgcggcatcaccaccagcggcgtgttctcgcccagcctc
aaacaatccatcgccatcgcccgcgtacccaaagattttgacggcgatgcggccaaagtc
gtcattcgcggcaaagaagccgatgtgcgcgtgttgaaactgccgtttgtacgcaacggg
caaaagcagtttgactaa

DBGET integrated database retrieval system