KEGG   Neisseria sp. KEM232: CGZ77_05905Help
Entry
CGZ77_05905       CDS       T05913                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
nek  Neisseria sp. KEM232
Pathway
nek00564  Glycerophospholipid metabolism
nek01100  Metabolic pathways
nek01110  Biosynthesis of secondary metabolites
Module
nek_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:nek00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CGZ77_05905 (psd)
Enzymes [BR:nek01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CGZ77_05905 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ASP17317
Position
1197067..1197969
Genome map
AA seq 300 aa AA seqDB search
MSELRPYPAPTYRQRLKTAFHYLLPQLAVTRAAGWLAERRWGVLTHAVIKTFAACYKINM
AEAEKSRAADYASFNEFFIRKLKDGARPIDADPQTLVLPADGRVSEAGAIEAGRLIQAKG
HDFTALELLAGDEALAAEFSDGLFLTTYLSPRDYHRVHMPCDAALRRMIYVPGELYSVNP
FLAQHIPNLFARNERLICVFDTEFGTMVQILVGATVTASISTVWAGIINPPRSKSVLQWL
YPAEGEGAVRLAKGQEMGAFRLGSTVINLFPKNSIRLNGSLAAGAPVRMGEALGVRADAG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaactgcgcccctatcccgccccgacctaccggcagcgcctcaaaaccgccttc
cattatctgctgccgcagctggcagtcacccgcgccgcaggctggctggccgaacgccgc
tggggcgtgctcacccatgccgtgatcaaaaccttcgccgcctgctacaaaatcaacatg
gccgaagcggaaaaaagccgcgcggccgactacgccagcttcaacgaatttttcatccgc
aaactcaaagacggcgcgcgccccatagacgccgacccgcaaacccttgttttgcccgcc
gacggccgcgtcagcgaagcaggcgccatcgaagcggggcggctgatacaggccaaaggc
cacgacttcaccgccctcgaactgctggcgggcgacgaagcgctggccgcagagttttca
gacggcctcttcctcaccacctacctctccccgcgcgactaccaccgcgtccatatgccc
tgcgatgccgccctgcgccgcatgatctacgttccgggcgaactctattccgtcaacccc
tttctcgcgcagcacatccccaacctcttcgcccgcaacgagcgcctgatctgcgtgttc
gacaccgagttcggcacaatggtgcagatactcgtcggtgcaaccgtcaccgccagcatc
agcaccgtatgggcgggcatcatcaacccgccgcgcagcaaaagtgttttgcaatggctc
tatcccgccgaaggcgaaggcgcggtgcggctggcaaaagggcaggaaatgggcgccttc
cgcctcggttcgaccgttatcaacctgttcccgaaaaacagcatccgcctgaacggcagt
cttgccgcaggagcgcccgtacgcatgggcgaagccctcggcgtgcgcgctgatgcgggc
tga

DBGET integrated database retrieval system