KEGG   Neisseria sp. KEM232: CGZ77_11710Help
Entry
CGZ77_11710       CDS       T05913                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
nek  Neisseria sp. KEM232
Pathway
nek00471  D-Glutamine and D-glutamate metabolism
nek01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nek00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CGZ77_11710
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nek01011]
    CGZ77_11710
Enzymes [BR:nek01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     CGZ77_11710
Peptidoglycan biosynthesis and degradation proteins [BR:nek01011]
 Precursor biosynthesis
  Racemase
   CGZ77_11710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race XPG_I
Motif
Other DBs
NCBI-ProteinID: ASP18326
Position
2349950..2350762
Genome map
AA seq 270 aa AA seqDB search
MDTVRQRPIGVFDSGVGGLTNVRALMERLPMENIVYFGDTARVPYGVKSRATIENFTAQI
VGFMLEHDVKALVIACNTIAAVAGHKVRQMAGNMPVLDVISAGAQAALQVTRNNHIGVLA
TNTTVNSNAYAREIHRHRPEARVQSQACPLFVPLVEEGWLDHEVTRLTAREYLKPLLAED
ADTLVLGCTHYPLLKPLLHREAPHLQLVDSAVTTAEAVARALQEKDLLNDGSGGAADYRF
YVSDIPLRFQTIGERFLGRSLQQIEMVTLG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggatacagtcagacagcgccccatcggagtgttcgattcgggagtgggcggccttacc
aacgtgcgtgccctgatggagcgcctgccgatggaaaacatcgtctatttcggcgacacc
gcccgcgtaccctacggcgtcaaatcccgcgccaccatcgaaaacttcaccgcgcaaatc
gtcggcttcatgctcgaacacgacgtcaaagccctcgttatcgcctgcaacaccatcgcc
gctgtggccggccacaaagtgcggcagatggcgggcaatatgcccgtactcgacgtgatt
agcgccggcgcacaggctgccctgcaggtcacccgcaacaaccacatcggcgtactggcc
accaacaccaccgtcaacagcaacgcctacgcccgcgaaatccaccgccaccgccccgaa
gcacgcgtccagtcgcaggcctgcccgctgtttgtgccgctggtagaagaaggctggctc
gaccacgaagtcacccgcctcaccgcccgcgaatacctcaaaccgctcctagccgaagac
gcggacacgctggtgctcggctgcacgcactacccgctgctcaaacccctgctgcaccgc
gaagcgccgcacctgcaactggtcgactccgccgtcaccaccgccgaagccgttgcccgc
gccctgcaggaaaaagacctgcttaacgacggcagcggcggcgcggctgactaccgtttc
tacgtcagcgacatcccgctgcgcttccaaaccataggcgaacgttttttgggacgcagc
ctgcagcagatagaaatggtgacgctgggctga

DBGET integrated database retrieval system