KEGG   Neisseria elongata: NELON_08795Help
Entry
NELON_08795       CDS       T03569                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nel  Neisseria elongata
Pathway
nel00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NELON_08795
Enzymes [BR:nel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NELON_08795
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NELON_08795
    1.1.1.-  
     NELON_08795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 TrkA_N Semialdhyde_dh 2-Hacid_dh_C 3HCDH_N NAD_binding_2 AdoHcyase_NAD HI0933_like
Motif
Other DBs
NCBI-ProteinID: AJE18980
UniProt: A0A0B5CQT7
Position
complement(1672198..1673262)
Genome map
AA seq 354 aa AA seqDB search
MKAARFYDKGDIRIEDIPEPTVAPGTVGINVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPVTMGHEFSGVVYAVGEGVDDIKVGQHVVVEPYIVRDDVPTGPGSNYHLSKDMNF
IGLGGCGGGLSEKIAVKRRWVHPISDKIPLDQAALIEPLSVGHHAYVRSGAKAGDVALVG
GAGPIGLLLAAVLKAKGIKVIITELSKARKDKARESGVADYILDPSEVDVVEEVKKLTNG
EGVDVAFECTSVNKVLDTMVEACRPTAKVVIVSIWSHPATINVHSVVMKELDVRGTIAYC
NDHAETIKLVEEGKINLEPFITQRIKLDELISEGFERLIHNNESAVKIIVNPNL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgtttttacgataaaggcgatatccgcatcgaagatatccccgaaccg
accgtcgcccccggcaccgtcggcatcaatgtcgcctggtgcggcatctgcggcaccgac
ctgcacgaatttatggaaggcccgattttcatcccgccctgcggccatccgcatccgatt
tccggcgagtccgcgcccgtaacgatgggacacgagttctccggcgtggtttatgccgtc
ggcgaaggcgtggacgatattaaagtcggccaacacgttgtggtcgaaccttacatcgtg
cgcgatgacgtaccgaccggcccaggcagcaactaccacctctccaaagacatgaacttc
atcggcttgggcggttgcggcggtggcttgtccgaaaaaatcgccgtcaaacgccgctgg
gtgcatccgatttccgacaaaattccgttagaccaagccgctttgattgaacccctgtcc
gtcggccatcacgcttatgtccgcagcggcgcgaaagcaggcgacgtggcattggtcggc
ggcgcaggcccgatcggtttgctgcttgccgccgtgttgaaagccaaaggcatcaaagtt
atcatcaccgaattgagcaaagcgcgcaaagacaaagcccgcgaatccggcgttgccgac
tacatcctcgacccgtccgaagtcgacgtcgtcgaagaagtgaaaaaactgaccaacggc
gaaggcgtggacgtcgcattcgaatgcaccagcgtcaataaagtgctggacaccatggtc
gaagcctgccgtccgaccgcgaaggtcgtcatcgtatccatctggagccaccccgccacc
atcaacgtccacagcgtcgtgatgaaagagctggacgtgcgcggcaccatcgcctactgc
aacgaccacgccgaaaccatcaaactggtggaagaaggaaaaatcaacctcgaacctttc
atcacccagcgcatcaagctggacgagctgatttccgaaggcttcgagcgtctgattcac
aacaacgaatccgccgtcaaaatcatcgtcaatccgaacctgtaa

DBGET integrated database retrieval system