KEGG   Neisseria elongata: NELON_08945Help
Entry
NELON_08945       CDS       T03569                                 

Definition
(GenBank) acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
nel  Neisseria elongata
Brite
KEGG Orthology (KO) [BR:nel00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NELON_08945
Enzymes [BR:nel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     NELON_08945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AJE19007
UniProt: A0A0B5CIY4
Position
1702972..1703775
Genome map
AA seq 267 aa AA seqDB search
MRKIRAAVIQTVSGTDPAANTAAMRRLVRQAAEQGADWALLPEYWPLMGQNDRDKLALAE
PFGSGTLQQAMAETAAECGVTLFGGTIPLQSPAPDKVLNSLLAYDKNGECTGRYDKMHLF
GYSGLGERYAEADTIAAGCEVPHLTADGWNLAQGICYDLRFPEFFRAQSPFDALLLPAAF
THTTGKAHWELLLRARAVENQCYVLAAGQGGLHESGRRTFGHSMIIDPWGEILAVLPEGE
GVITAELNPARLNSVRQRLPALAHRIL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaaatccgtgccgccgtcatccaaaccgtttccggcaccgaccccgccgccaat
accgccgccatgcgccgcctggtgcgccaagcggcagagcaaggtgcggattgggcgttg
ctgcccgaatattggccgctgatggggcaaaacgaccgcgacaaactcgcactggccgag
cctttcggcagcggcaccctgcaacaggcgatggccgaaaccgccgccgaatgcggcgtt
accctgttcggcggcacgattccgctgcaatcgcccgcacccgacaaagtattaaacagc
ctgctggcatacgacaaaaacggcgaatgtaccggccgctacgacaaaatgcacctgttc
ggctattcgggcttgggcgaacgctacgccgaagccgacaccatcgccgccggctgcgaa
gtcccccatctgactgccgacggctggaatctggcgcaaggcatctgctacgatctgcgc
ttccccgaatttttccgcgcccaaagcccgtttgacgcgcttttgctgcccgccgccttc
actcacaccacaggcaaggcacattgggaactgctgctgcgcgcccgtgcggtggaaaac
caatgctacgttttggcggccggacagggcggcctgcacgaaagcggccgccgcaccttc
ggccacagcatgattatcgacccctggggcgaaatcctggccgtgctgcccgaaggggaa
ggcgtaattaccgccgaactcaaccccgcgcggctgaacagcgtgcggcagcgtctgccc
gcactggcacaccgcatcctgtaa

DBGET integrated database retrieval system