KEGG   Neorhizobium sp. NCHU2750: NCHU2750_02820Help
Entry
NCHU2750_02820    CDS       T05650                                 

Gene name
glf
Definition
(GenBank) UDP-galactopyranose mutase
  KO
K01854  UDP-galactopyranose mutase [EC:5.4.99.9]
Organism
nen  Neorhizobium sp. NCHU2750
Pathway
nen00052  Galactose metabolism
nen00520  Amino sugar and nucleotide sugar metabolism
nen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NCHU2750_02820 (glf)
   00520 Amino sugar and nucleotide sugar metabolism
    NCHU2750_02820 (glf)
Enzymes [BR:nen01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.9  UDP-galactopyranose mutase
     NCHU2750_02820 (glf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GLF NAD_binding_8 Amino_oxidase FAD_binding_3 ApbA DAO Pyr_redox_2 Pyr_redox NAD_binding_9 3HCDH_N DUF1188 FAD_binding_2 TrkA_N Arm-DNA-bind_3
Motif
Other DBs
NCBI-ProteinID: AYC99679
UniProt: A0A386DSR0
Position
295974..297122
Genome map
AA seq 382 aa AA seqDB search
MTKPILIVGAGLSGAVIGRELAEAGHAVKIIDRRPHIAGNCHTERDEATGVMVHVYGPHI
FHTNDEEVWAYVNAHMRFMPYVNRVKTTSGDKVYSLPVNLHTINQFFGKTLRPDEAKAFI
ASLSDPAIGEPVTFEDQALKFVGRDLYGAFFEGYTRKQWGCSPADLPASILKRLPVRFNY
DDNYFAHRFQGMPEHGYTEMVAGILDHGNIEVELKQEFSRTEAANFAHVFYSGPLDGYFG
YELGRLGYRTLDFEPFRYEGDYQGCAVMNYGDVEIPYTRITEHKHFSPWEDHEKSICYRE
FSRECGPSDTPYYPIRLSGEQALLSQYVERARQEKDVTFVGRLGTYRYLDMDVTIREALD
TAKACLAAIAAGEAMPVFSVEP
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaccaatcttgattgtcggtgccggcctgtccggcgccgtcatcggccgggaa
ctggccgaagccggccatgcggtgaagatcatcgatcgccgcccgcacatcgccggtaac
tgccacaccgagcgcgacgaagcgaccggtgtcatggtgcatgtctatggcccccatatc
ttccataccaatgacgaggaagtctgggcttacgtcaacgcccatatgcgcttcatgccc
tatgtgaaccgggtgaagacgacgagcggcgacaaggtctattcgctgccggtcaacctc
cacacgatcaaccagttcttcggcaagacgctgcggcccgacgaggcgaaggcgttcatc
gcctctctttccgatcccgccatcggcgagcccgtcaccttcgaggaccaggcgctgaaa
ttcgtcggtcgcgatctctatggggctttcttcgaaggctatacgcgcaagcagtggggt
tgctccccggccgacctgccggccagcattctcaagcgcctgccggtccgcttcaattac
gacgacaactatttcgcccatcgtttccagggcatgcccgaacatggctatactgaaatg
gtggcaggcattctggaccacggcaatatcgaggttgaactcaagcaggaattctcccgc
acagaggccgccaacttcgcacatgtcttctattccggcccgcttgacggctatttcggc
tacgaactcggccggctcggctaccgtacgctggatttcgagcccttccgctacgagggc
gactatcagggctgcgccgtgatgaattacggggatgtggagataccctatacccgcatc
accgagcacaagcatttctcgccctgggaagaccacgagaagagcatctgctatcgcgaa
ttctcccgcgaatgcggaccgagcgatacgccctattatccgatcaggctgagcggcgag
caggccctcctgtcgcaatatgtggagcgcgcccggcaggaaaaggacgtcaccttcgtc
ggccgcctcggcacttaccgttatctggacatggacgtcacgatccgcgaggcgctcgat
acggccaaggcctgccttgccgccatcgcggccggcgaggccatgccggtcttcagcgtg
gagccgtga

DBGET integrated database retrieval system