KEGG   Neorhizobium sp. NCHU2750: NCHU2750_03590Help
Entry
NCHU2750_03590    CDS       T05650                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
nen  Neorhizobium sp. NCHU2750
Brite
KEGG Orthology (KO) [BR:nen00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    NCHU2750_03590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AYC99756
UniProt: A0A386DT21
Position
complement(392998..394584)
Genome map
AA seq 528 aa AA seqDB search
MVLATIADSRTMAQQKPRLAKPTLDKDLEKLSSVEDAARYTARGLAAPGTALLFIILTAI
FASSYVTGKPGAIIIIAAAALAGYMAMNIGANDVTNNIGAAVGARAMSMGFGLALAAVFE
VAGAVLAGGGVVHTIASGIMADTATASPDMLIWAMMAAMLSAAVLVNVATWAGAPISTTH
SIVGGVMGAGIAAAGFGAVNWEMVAGITASWVISPLLGGVIAAGFLLFVKETIIYREDKI
ASAKTWVPVLIGIMTGAFAGYLALIGFDQFLERSALRATIIALICGLIAWRALIPVINRQ
AEGLENRNQSLRKLFRIPLILSAALMSFAHGANDVSNAIGPMAAIVSAAQNGLVESVHVP
TWELVIGGLGISLGLLLYGPKLVRLVGGEITKLNPMRAYCVSLSTALTVIVASWVGLPVS
STHIAVGAVFGVGLFREWYTRNSRRRYEYMRVRAGKDADSEADEKPNGKAGDKPSDRGSS
ERNEYETRRRYLVRRSHMLSIIAAWMITLPAAAGLAAIIATVMFSLFL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggttctggcaacgatcgccgacagcaggaccatggcacagcagaaaccgcgtctcgcc
aagccgacgctcgacaaggatctcgaaaagctttcctccgtggaagacgccgcccgttac
acggcgcgggggctggcggcacccggcacggcgctgctgttcatcatcctgacggcgatc
ttcgcctcgtcctatgtgaccggaaaaccgggggcgatcatcatcatcgcggcggcggca
cttgccggctacatggcgatgaatatcggcgcaaacgacgtgaccaacaatatcggcgcg
gccgtcggggcgcgcgccatgtcaatgggcttcggactggcgcttgccgccgtgttcgag
gtggccggtgccgtgttggccggcggtggcgtggtgcatacgattgccagcggcatcatg
gcggatacggcgaccgcaagtccggacatgctgatctgggcgatgatggcagcgatgctg
tctgccgccgtgctggtcaatgtggcgacctgggccggcgcgccgatctcgaccacccat
tcgatcgtcggcggagtgatgggcgccgggattgcggccgccggcttcggtgcggtcaac
tgggaaatggtggccggcattaccgcaagctgggtgatctcgcccctgctcggcggggtg
atcgccgccggcttcctgctcttcgtcaaagagacgatcatctaccgcgaagacaagatc
gcctcggcaaagacctgggttccggtcttgatcggcatcatgacgggtgcctttgccgga
tatctggcgctgatcggcttcgaccagtttctcgaaaggtctgcgctcagggcgaccatc
atcgcacttatctgcgggcttattgcctggcgggcgctgatcccggtcatcaatcgacag
gccgaggggctggaaaaccgcaaccagtcgctgcgcaagctgtttcgcattccgctcatc
ctgtcggcggcgctgatgtcgttcgcgcacggggccaatgacgtgtcgaacgcgatcggg
ccgatggccgccatcgtctccgccgcgcagaacgggctggtggagagtgtccatgtgccg
acctgggagcttgtcatcggcgggctcggcatctcgctcggccttttgctctacgggccg
aaacttgtgcggctggtgggtggcgagatcaccaagctcaatccgatgcgggcctattgc
gtgtcgctatcgacggcgctgaccgtgatcgtcgcctcgtgggtggggctgccggtttcc
tccacccatatcgccgtcggcgcggtgttcggcgtcggcctgttccgtgaatggtacacg
cgcaattcgaggcggcgctacgaatacatgcgggtgcgtgccgggaaggatgccgacagc
gaggccgatgaaaagccaaacggcaaagcgggcgacaaacctagcgacaggggttcctcc
gaacggaacgagtatgaaacgaggcggcgatacctggtgcgccgttcgcatatgctcagc
atcattgcggcatggatgatcacgcttccggccgcagcaggccttgcggcgatcatcgcg
acggttatgttctcgctgtttctgtaa

DBGET integrated database retrieval system