KEGG   Neorhizobium sp. NCHU2750: NCHU2750_05440Help
Entry
NCHU2750_05440    CDS       T05650                                 

Gene name
hadL
Definition
(GenBank) 2-haloalkanoic acid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
nen  Neorhizobium sp. NCHU2750
Pathway
nen00361  Chlorocyclohexane and chlorobenzene degradation
nen00625  Chloroalkane and chloroalkene degradation
nen01100  Metabolic pathways
nen01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nen00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NCHU2750_05440 (hadL)
   00361 Chlorocyclohexane and chlorobenzene degradation
    NCHU2750_05440 (hadL)
Enzymes [BR:nen01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     NCHU2750_05440 (hadL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase
Motif
Other DBs
NCBI-ProteinID: AYC99941
UniProt: A0A386DTN9
Position
complement(581521..582135)
Genome map
AA seq 204 aa AA seqDB search
MAGQIDHIVFDIGKVLIHYDPNLPFSRIIPDAEERKWFFQNVCTHDWNLEQDRGRKWEDA
EALLIAEHPDREEHIRAFRKHWHEMVPHAYDGSVALMLELIDKGHDVTMLTNFAADTFVE
ARKIYPFLNATRGVTVSGEIGLIKPDVAIYERHAKDFGLAPERSIFIDDTLVNVEGARAA
GWQAVHFKDADTLRQDLIAHGVSI
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcaggccagatcgaccacatcgtcttcgacatcggcaaggttctcatccattacgat
ccgaacctgcccttcagccgcatcattcccgatgcggaggagcgaaaatggttcttccag
aatgtctgcacccatgactggaacctggaacaggatcgcggccgcaaatgggaggatgcc
gaggcgctgctgattgccgagcatcccgatcgcgaggagcatatccgcgccttccgcaag
cattggcacgagatggtgccgcatgcctatgacggctcggtcgccctgatgctcgaactg
atcgacaagggccatgacgtgacgatgctgacgaactttgccgctgacacattcgtcgag
gcgcgcaagatctatccgttcctcaatgcgacgcgcggcgtgaccgtttcgggcgagatc
gggctgatcaagccggatgtggcgatctacgaacggcatgccaaggatttcggccttgcg
ccggaacggtcgatcttcatcgacgatacgctggtgaatgtggaaggcgcgcgggccgca
ggctggcaggcggtgcatttcaaggatgccgatacgctgcgtcaggatctcatcgcccac
ggcgtttcgatctga

DBGET integrated database retrieval system