KEGG   Neorhizobium sp. NCHU2750: NCHU2750_26090Help
Entry
NCHU2750_26090    CDS       T05650                                 

Gene name
rluD
Definition
(GenBank) 23S rRNA pseudouridine 1911/1915/1917 synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
nen  Neorhizobium sp. NCHU2750
Brite
KEGG Orthology (KO) [BR:nen00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:nen03009]
    NCHU2750_26090 (rluD)
Enzymes [BR:nen01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     NCHU2750_26090 (rluD)
Ribosome biogenesis [BR:nen03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    NCHU2750_26090 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2 ThiS
Motif
Other DBs
NCBI-ProteinID: AYD01994
UniProt: A0A386E0T4
Position
2687352..2688377
Genome map
AA seq 341 aa AA seqDB search
MSETISEAGLPRKVLNAGEDDGGRLDAWLTAQLDGELSRSRVKALIEEGAISINGKIVTE
AKKKVSPGDVIELVLPEPEDPEPKGENIPLEVLYEDDDLIVIAKPAGLVVHPGAGNWTGT
LVNALIYHCGASLSGIGGVKRPGIVHRLDKETSGVMVAAKNDIAHRHLADQFADHGRSGD
LERAYQAVVWGRPSHLHGTIDAPLGRSSADRTKRAVKREDSADARHAVTHYEVVERFQET
PDATALASLIECRLETGRTHQIRVHMAHVGNPLIGDPEYAGGFRTKANRLPEPAKSVVGA
FPRQALHAFLLAFEHPRTGEIMEFEAPMPDDMDALIEALRG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaccattagcgaagccgggctgccaaggaaagtcctcaatgcgggcgaggac
gatggcggccggctggacgcgtggctgacggcacaactggatggagaactgtcgcgcagc
cgggtcaaggccttgatagaagaaggcgcgatcagcatcaacggcaagatcgtcacggaa
gccaagaagaaggtctctcccggcgatgtgatcgaactcgtcctgcccgaaccggaagac
cccgaacccaagggcgaaaacatcccgctcgaagtgctttacgaggatgacgacctgatc
gtcatcgccaagcccgccggcctcgtcgtccatcccggcgccggcaactggaccggcacg
ctggtcaatgcgctgatctatcactgcggtgcaagcctgtccggcattggcggcgtcaag
cggcccggcatcgtccaccgtctcgataaggagacgagtggcgtcatggtcgccgccaag
aacgatatcgcccatcgccatctcgccgaccagttcgccgaccacggccgatcgggcgat
ctggagcgcgcctaccaggccgtcgtctggggccgcccaagccatctgcacggcacgatc
gatgcgccgctcggccgctccagcgccgaccgcaccaagcgggcggtcaagcgcgaggat
tctgccgatgcccgccatgccgtgacccactacgaagtggtcgaacgttttcaggaaacg
cccgacgccacggcgctcgcatccctgatcgaatgccggctcgagacgggccgcacccac
cagatccgcgtccacatggcccatgtcggcaatccgctgatcggtgatcccgaatatgcc
ggcggcttcaggaccaaggccaatcgcctgccggaaccggcaaagagcgtcgtcggcgcc
tttccccgccaggcgctgcatgccttcctgctcgccttcgaacacccccgcaccggcgag
atcatggaattcgaggcgccgatgcccgacgacatggacgccctgatcgaggcgctgcgg
ggataa

DBGET integrated database retrieval system