KEGG   Neorhizobium sp. NCHU2750: NCHU2750_26140Help
Entry
NCHU2750_26140    CDS       T05650                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nen  Neorhizobium sp. NCHU2750
Pathway
nen00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NCHU2750_26140
Enzymes [BR:nen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NCHU2750_26140
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NCHU2750_26140
    1.1.1.-  
     NCHU2750_26140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AYD01999
UniProt: A0A386E3D4
Position
2692660..2693715
Genome map
AA seq 351 aa AA seqDB search
MKAARWYSAKDIRVEEVTEPKPTAGQVKIKVKWTGICGSDLHEYVAGPIFVPVKAPHPVS
HDIAPIIMGHEFSGEVSEVGEGVERVKPGDRVVVEPILACGKCDACLHGKYNLCDSLGFH
GLSGGGGGFATYTTVGERWVHKMPEGLSYEQGALVEPAAVALHAVRISSLKAGGTAAVFG
AGPIGLLVVEALKVAGASAIHVVELSPQRGAKAIELGATSVIDPSKENAAQRIRELTPGG
VDVTFEVTGVPSVLQQCIDATRYEGETVIVSIWEKEAPFQPNTVVLKEKSLKGTIAYRDV
FPAVMNLMVQGYFSADKLVTKRIELDDIVPQGFDTLVAEKSQIKILVRSPD
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgctggtacagcgccaaggatatccgcgtcgaggaagtcaccgaaccg
aagccgaccgcgggccaggtcaagatcaaggtcaagtggaccggcatctgcggcagcgac
ctgcatgaatacgtggcaggcccgatcttcgtgccggtcaaggcgccccatccggtcagc
catgacatcgcaccgatcatcatgggtcacgaattctccggtgaagtgtcggaagtcggt
gaaggtgtggagcgcgtcaagccgggcgaccgcgtcgtcgtcgagccgatcctcgcctgc
ggcaagtgcgatgcctgcctgcatggcaaatataacctctgcgacagcctcggcttccac
ggcctctccggcggaggcggcggctttgccacctatacgacggtcggcgagcgctgggtc
cacaagatgccggaaggcctgtcctacgaacagggcgccctcgtcgagccggcagccgtc
gccctccacgccgtgcgcatttctagccttaaggccggcggcaccgcagccgtcttcggc
gccggcccgatcggccttctcgtcgtcgaggcgctcaaagtggccggcgcctccgccatc
catgtcgtcgaactgtcaccgcagcgcggcgccaaggcgatcgagctcggtgccaccagc
gtcatcgacccgtcgaaggagaacgctgcccagcgcatccgcgaactgacgcccggcggc
gtcgacgtgacattcgaagtcaccggcgtgccttcggtcctgcagcaatgcatcgacgcg
acccgctacgagggcgagacggtgatcgtctcgatctgggaaaaggaagcccccttccag
cccaatacggtggtgctgaaggaaaagagcctgaagggcacgattgcctaccgggatgtc
ttcccagccgtcatgaacctgatggtccagggctatttctccgccgacaagctggtgacc
aagcgtatcgagctcgacgatatcgtgccccagggttttgacacgctggtggctgaaaag
agccagatcaagatcctcgtccgctcccccgattga

DBGET integrated database retrieval system