KEGG   Neorhizobium sp. NCHU2750: NCHU2750_26360Help
Entry
NCHU2750_26360    CDS       T05650                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nen  Neorhizobium sp. NCHU2750
Pathway
nen00010  Glycolysis / Gluconeogenesis
nen00053  Ascorbate and aldarate metabolism
nen00071  Fatty acid degradation
nen00280  Valine, leucine and isoleucine degradation
nen00310  Lysine degradation
nen00330  Arginine and proline metabolism
nen00340  Histidine metabolism
nen00380  Tryptophan metabolism
nen00410  beta-Alanine metabolism
nen00561  Glycerolipid metabolism
nen00620  Pyruvate metabolism
nen00625  Chloroalkane and chloroalkene degradation
nen00903  Limonene and pinene degradation
nen01100  Metabolic pathways
nen01110  Biosynthesis of secondary metabolites
nen01120  Microbial metabolism in diverse environments
nen01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCHU2750_26360
   00053 Ascorbate and aldarate metabolism
    NCHU2750_26360
   00620 Pyruvate metabolism
    NCHU2750_26360
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NCHU2750_26360
   00561 Glycerolipid metabolism
    NCHU2750_26360
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NCHU2750_26360
   00310 Lysine degradation
    NCHU2750_26360
   00330 Arginine and proline metabolism
    NCHU2750_26360
   00340 Histidine metabolism
    NCHU2750_26360
   00380 Tryptophan metabolism
    NCHU2750_26360
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NCHU2750_26360
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NCHU2750_26360
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NCHU2750_26360
Enzymes [BR:nen01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     NCHU2750_26360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AYD02021
UniProt: A0A386E0S1
Position
complement(2716527..2717951)
Genome map
AA seq 474 aa AA seqDB search
MSNHLKFFINGEWVEPVVPVALDVIDPSTEEAFTQIAVGSKADVDKAVAAAKAAFKSFSQ
WSQVDRLALLKRILAEYEKRAEDIAQAVSREMGAPIGFARDSQVAAGHGHLSATITALET
YKFSEDRGTTRVVKEPIGVVALITPWNWPLNQITCKVGPAIATGCTMVLKPSEIAPISGV
IFAEVMEAAGVPKGVFNMVNGTGPDVGQVMAGHPDVDMVSFTGSTRAGIIVAKTAADTVK
RVAQELGGKSANIILPDADLSQAVSDGVTGCFGNSGQSCDAPTRMLVPRERHDEALAVAK
AAAEKLVTGDPQADGIDLGPVVSKVQFDKIQRLIEAGIAEGATLVTGGPGRPENLNRGYY
IRPTVFGNVTNDMTIAREEIFGPVLSILPYDSEEQAIEIANDTPYGLAAYVQGEPDHARK
IAPFLRAGSVYLNYPDWDLFSSFGGYKQSGNGREYADWGIHDFLEIKSVVGYGN
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcatctgaaattcttcatcaatggcgaatgggtggagccggtggttcccgtg
gcgctcgatgtcatcgacccatcgacggaagaggccttcacgcagatcgcggtcggttcc
aaggcggatgtcgacaaagcagtggcggctgccaaggctgcattcaagagcttttcgcag
tggtcgcaggtcgaccggctggcgctgttgaaacgcattctggcggaatatgaaaagcgg
gcggaagacatcgcccaggctgtcagccgggagatgggcgcgccgatcggctttgcccgc
gatagccaggtcgcggccggtcacgggcatctgagcgcgacgatcacggcgctcgaaacc
tacaagttttccgaggaccgcggcacgacgcgggtggtgaaagagccgatcggcgtggtg
gcactgatcacgccatggaactggccgctcaaccagatcacctgcaaggtcggtccggcg
atcgccaccggctgcacgatggtgctcaagccctccgagatcgcgccgatctccggcgtc
atcttcgccgaggtgatggaggccgccggcgtgccgaagggcgtgttcaacatggtcaac
ggcaccggcccggatgtcggccaggtgatggccgggcatccggatgtcgacatggtgtcg
ttcaccggctcgacgcgcgccggcatcatcgttgccaagacggcagccgatacggtgaaa
cgcgtggcgcaggaactcggcggcaagtcggccaatatcatcctgcccgatgccgatctt
tcccaggcggtttccgatggcgtgacgggatgcttcggcaattccgggcagtcctgcgat
gcgccgacgcgcatgcttgtgccgcgcgagaggcatgacgaggcgctggcggtggccaag
gctgctgcggaaaagctcgtgaccggcgatccgcaggccgacggcatcgatcttggcccc
gtcgtcagcaaggtgcagttcgacaagatccagcggctgatcgaagcgggtattgcggag
ggtgcgacgctggtcaccggcggtcctggccggccggaaaacctcaatcgcggctattac
attcgcccgaccgtgttcggtaacgtcaccaacgacatgacgatcgcgcgcgaggaaatc
ttcggaccggtcctgtcgatcctgccctatgacagcgaggagcaggcgatcgagatcgcc
aacgacacgccttatgggctggcggcctatgtgcagggtgagccggaccatgctcgcaag
atcgcgccgttcctgcgggccggctcggtctatctcaactatcccgactgggatctgttc
tcctccttcggcggttacaagcagtccggcaacgggcgcgagtatgccgactggggcatc
cacgatttcctcgagatcaagagcgtcgtcggctatggcaattaa

DBGET integrated database retrieval system