KEGG   Neorhizobium sp. NCHU2750: NCHU2750_37740Help
Entry
NCHU2750_37740    CDS       T05650                                 

Gene name
aceB
Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
nen  Neorhizobium sp. NCHU2750
Pathway
nen00620  Pyruvate metabolism
nen00630  Glyoxylate and dicarboxylate metabolism
nen01100  Metabolic pathways
nen01110  Biosynthesis of secondary metabolites
nen01120  Microbial metabolism in diverse environments
nen01200  Carbon metabolism
Module
nen_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCHU2750_37740 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    NCHU2750_37740 (aceB)
Enzymes [BR:nen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     NCHU2750_37740 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase Chlamy_scaf
Motif
Other DBs
NCBI-ProteinID: AYD03159
UniProt: A0A386E6D6
Position
3961415..3963595
Genome map
AA seq 726 aa AA seqDB search
MARMDVAGLQISDFLYRFLVDEALPGTGVDASAFFAGFSGIVHDLAPKNRALLAKRDAFQ
ETLDDWYRQNGAPSDLVAYEAFLREIGYLLPEGEDFKVSTENVDPEIAQIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIPETDGAEKGKAYNPVRGARVIAWVRDFLDQSAPL
AGGRWKDVAALRIDNAALFVTMADGAVTGLVDPSQFAGYLGEAAAPKQVLLTKNRLHVEI
VIDRTTEIGSTDAAGIADVRAESAITTIMDCEDSVAAVDAKDKVTVYRNWLGLMKGDLTE
EVSKGDRSFTRRLNPDLNYMAPDGSSFKLKCRSLMLVRNVGHLMTNPAILDRDGNEVPEG
IMDAMVTALIAIHDIGRPAGPAGRRQNSATGSIYVVKPKMHGPEEVAFAAEIFSRVEQVL
GLSRHAMKMGIMDEERRTTVNLKEAIRAASDRVVFINTGFLDRTGDEIHTSMEAGPMIRK
GDMKQAPWIAAYENWNVDIGLECGLSGHAQIGKGMWAMPDLMAAMLEQKIGHPKAGANTA
WVPSPTAATLHATHYHRIDVAAVQQSLKSRGRAKLSDILSVPVASRPNWTAEEIGRELDN
NAQGILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHMANWLHHKVVTQDQIVE
TMKRMASVVDGQNAGDPLYRPMAGNFDSSIAFQAALDLVLKGREQPNGYTEPVLHRRRIE
LKTRAS
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcatggatgtcgccggtcttcagatatcagattttctttaccggtttttggtt
gacgaggcgcttcctggtacgggggttgatgcgtctgcgttctttgcgggcttttcgggt
atcgtgcacgaccttgccccgaagaaccgggcgctgctggcaaagcgtgatgccttccag
gagacgctcgacgactggtatcggcagaacggcgcgccgagcgatctggtcgcttatgag
gcctttttgcgtgagatcggctacctgcttcccgagggtgaggacttcaaggtctcgacc
gaaaatgtcgatccggagattgcccagatcgccggaccgcagctggtcgtgccggtgatg
aatgcccgctatgcgctgaatgccgccaatgcccgctggggctcgctctacgatgcgctc
tacggcaccgatgcgatccccgagaccgatggcgccgagaagggtaaagcctacaatcct
gtccgcggcgccagggtcatcgcctgggtgcgcgacttcctcgatcagtcggcaccgctt
gccggcgggcgctggaaggacgtggccgcacttcgcatcgacaatgccgcactcttcgtg
acgatggcggatggcgcggtaaccgggcttgtcgatccctcgcaatttgccggctatctc
ggagaggccgccgcaccgaagcaggtgcttctgacgaagaacaggctgcatgtcgagatc
gtcatcgacaggacgaccgagatcggcagcaccgatgcggccggcattgccgatgtcagg
gccgaatcggcgatcaccacgatcatggactgcgaggattcggtggccgcggtggatgcg
aaggataaggtcaccgtctaccgcaactggctcggcctgatgaagggcgacctgacggaa
gaggtgtcgaagggagacaggagcttcacccgcaggctcaatcccgatctgaactacatg
gcccccgacggttcgtccttcaagctcaagtgccgctcgctgatgctggtgcgcaatgtc
ggtcacctgatgaccaatccggccattctcgatcgcgacggaaacgaagtacctgaaggc
atcatggatgcgatggtgacggcgctgatcgccatccacgatatcggccgccccgcaggt
ccggccggccggcgccagaattccgcgaccggttcgatctacgtggtcaagccgaagatg
catgggccggaagaggtcgccttcgccgccgagatcttctcgcgcgttgaacaggtcctc
ggcctgtcgagacatgcgatgaagatgggcatcatggacgaggagcgccgcacgacggtg
aacctcaaggaagcgatccgtgcggctagtgatcgtgttgtcttcatcaataccggcttc
ctcgaccgcaccggcgacgagatccacacttcgatggaagccgggccgatgatccgcaag
ggggacatgaagcaggccccgtggattgcggcctatgagaactggaatgtcgatatcggg
ctggaatgcggcctgtctggccatgcgcagatcggcaagggcatgtgggcgatgccggac
ctgatggcggcgatgctggaacagaagatcggccatccgaaggcgggtgccaacaccgcc
tgggttccgtctccgacggcggccacgctgcatgccacccattatcacaggatagacgtg
gctgccgtgcagcagagcctgaagagccgcggccgggcaaaactctccgacattctctcg
gtgccggtggcatcacggccgaactggacggcggaggagatcggccgcgaactcgacaac
aatgcacagggcatactcggctatgtggtgcgctgggtcgaccagggcgtcggctgctcc
aaggtgccggacatcaacaatgtcgggctgatggaggaccgggccaccctgcgcatctcg
gcgcagcacatggccaactggctgcaccacaaggtggtcacgcaagatcagatcgtcgag
acgatgaagcgcatggcgagcgtggtggatggccaaaatgccggcgatccgctctaccgt
ccgatggctggcaacttcgacagctcgatcgccttccaggccgccctcgacctggtgctc
aagggccgcgagcagcccaatggctataccgaacccgtcctccaccgccgcaggatcgaa
ctcaagacgagggcaagctga

DBGET integrated database retrieval system