KEGG   Neorhizobium sp. NCHU2750: NCHU2750_47230Help
Entry
NCHU2750_47230    CDS       T05650                                 

Gene name
fucD
Definition
(GenBank) L-fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
nen  Neorhizobium sp. NCHU2750
Pathway
nen00051  Fructose and mannose metabolism
nen01100  Metabolic pathways
nen01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    NCHU2750_47230 (fucD)
Enzymes [BR:nen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     NCHU2750_47230 (fucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C Kin17_mid
Motif
Other DBs
NCBI-ProteinID: AYD04102
UniProt: A0A386E5M6
Position
pNCHU2750a:705244..706533
Genome map
AA seq 429 aa AA seqDB search
MTRITNLRVFDLRFPTSASLDGSDAMNPDPDYSAAYVILETDRDGISGHGLTFTIGRGND
ICCMAIEAMRHLVVGKDLSEMRAGPGKFWRHLTGDSQLRWIGPDKGAMHLATGAVVNALW
DALAKEAGMPVWKFVATMSPEEIADIVDYRYLTDALTRDEAIDILRKAEAGKAERIAILE
KDGYACYTTSAGWLGYPDDKLRRLAQEAVDAGFSHVKMKVGRDLEDDIRRLTICREVIGP
DRYMMIDANQVWDVDQAIDWVKALSFAKPYFIEEPTSPDDVAGHKKIREAIAPVKVATGE
MCQNRIMFKQFIAEGAIDIVQIDACRMGGLNEVLAVLLMAAKFGKAVWPHAGGVGLCEYV
QHLSMIDYIAVSGTKEGRVIEYVDHLHEHFVDPCIIRDAAYMPPSRPGFSIEMKPQSIEA
YQFGRPKAA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcatcaccaatcttcgtgtctttgatctgcgctttccgacttcggcaagcctc
gacggatcggatgcgatgaaccccgatccggattattcggcagcctatgtcattctcgaa
accgatcgtgacggcatttccggccatggcctgacctttaccatcggccgaggcaacgac
atttgctgcatggcaatcgaggcgatgcgtcatctggtcgtcggcaaggatctgtcggag
atgcgcgctggccccggtaaattctggcggcacctgaccggcgacagccagttgcgctgg
atcgggccggataagggcgccatgcatctggcgaccggtgccgtggtcaatgcgctctgg
gatgcgctcgccaaggaggcgggcatgccggtgtggaaattcgttgcgaccatgtcgccg
gaagagatcgccgatatcgtcgattaccgctatctcaccgatgcgctgacccgagatgag
gcgatcgatatcctgcgcaaggcggaagccggcaaggcagaacggatcgccattctcgag
aaggacggttacgcctgctacacgacgtccgccggatggctcggttaccccgacgataag
ctgcggcgcctggcgcaggaagccgtcgatgcagggttcagtcatgtgaagatgaaggtc
ggccgtgatttggaagatgatatccgccggctcaccatttgccgggaagtgatcggtccc
gatcgctacatgatgatcgatgcgaaccaggtctgggacgttgatcaggccatagactgg
gtgaaggcactctccttcgcaaagccttatttcatcgaggagccgaccagccccgacgat
gtggcaggacataagaagatccgcgaggcgatcgccccggtgaaggtcgcgaccggcgaa
atgtgccagaaccgtatcatgttcaagcagttcatcgccgaaggtgcgatcgatatcgtg
cagatagatgcttgccgcatgggcgggctgaacgaggtccttgcagtgctgctgatggcg
gcaaaattcggcaaggcggtctggccgcatgccggaggcgtcggcctttgcgaatatgtc
cagcacctgtcgatgatcgactacatcgctgtgtcaggtacgaaggaaggccgggtgatc
gaatatgtcgaccatctgcacgaacattttgtcgatccctgcatcatcagggacgccgcc
tatatgccgccgtcacgaccgggattctcgatcgagatgaagcctcagtcgattgaagca
tatcagttcggaaggccgaaggcggcttga

DBGET integrated database retrieval system