KEGG   Neorhizobium sp. NCHU2750: NCHU2750_51160Help
Entry
NCHU2750_51160    CDS       T05650                                 

Gene name
ltaE
Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
nen  Neorhizobium sp. NCHU2750
Pathway
nen00260  Glycine, serine and threonine metabolism
nen01100  Metabolic pathways
nen01110  Biosynthesis of secondary metabolites
nen01120  Microbial metabolism in diverse environments
nen01130  Biosynthesis of antibiotics
nen01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nen00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NCHU2750_51160 (ltaE)
Enzymes [BR:nen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     NCHU2750_51160 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AYD04494
UniProt: A0A386E7Q9
Position
pNCHU2750b:complement(387547..388584)
Genome map
AA seq 345 aa AA seqDB search
MAFKDDFRSDTVTRPEADMRGVMAAAEVGDAVYDDCPSTHRLETAAAERLGKEAALFFPT
GTQSNLAGLMAHCGRGDEYIVGQMAHTYRNEGGGAAVLGSIQPQPIANEADGSIALPAIE
AAIKPDDFHYARTRLLALENTFNGLVLSQTYLADASALARRRGLAVHLDGARLFNAAVAS
NCSADAIAGHFDTVSICLSKGLGAPVGSLLVGPRDLVERARRIRKMLGGGMRQTGVLAAA
GLYALDHNVSRLREDHARAIRLSEILSAYPELGAGAARTNMVFMSPQGIDIATFIAFMAE
RGIGIGGGYGTIRWVTHLDVDDASIERVAAACASFFESRTVARAS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcattcaaggacgatttccgatccgacacagtcacgcgtcccgaagcggacatgcgc
ggcgtcatggctgcggcggaggtgggcgatgcggtctatgacgattgcccctccacccat
cgtctggaaaccgctgctgccgagcgcttgggcaaagaagccgcgctgttctttccgaca
ggcacacagtccaatctggccgggctgatggcccattgcggtcgcggtgacgaatatatc
gtcggccagatggcgcatacctatcgcaacgagggaggcggtgccgcggttctgggctcg
atccagccgcagccgattgccaacgaagcggatggatcgatcgctttgcccgccattgag
gccgcgatcaagccggacgacttccattatgcccgcacgcgtcttctggcactggagaac
acgttcaacggactggttctctcccaaacatatttggcagacgcatctgcgctggcacgc
cggcgcggccttgccgtccatctggacggcgctcgcctgttcaatgcggcggttgcgtca
aactgcagtgctgacgcgattgccggccatttcgatacggtctcgatctgcctgtccaag
ggacttggtgccccggtaggctcacttctcgtcgggcctcgggatcttgtcgagcgagca
cggcggatccgcaagatgctcggaggcggcatgcgtcagaccggtgttcttgccgcggcg
gggctttatgcgctcgaccacaatgtctcccggctgcgggaggatcatgcaagagcgata
cgcttgtcggagatcctgtccgcctatccggaactcggcgcgggggcggcacgcaccaat
atggtcttcatgtcaccgcagggcatcgatatcgcgaccttcatcgccttcatggcagag
cgcgggatcggcatcggcggcggctatgggacaattcgatgggtgacacatctggatgtc
gatgacgcatcaatcgaacgggttgctgcggcatgtgccagctttttcgaaagccggacg
gtggcacgggcttcgtaa

DBGET integrated database retrieval system