KEGG   Neorhizobium sp. SOG26: CYG48_04620Help
Entry
CYG48_04620       CDS       T05626                                 

Gene name
rnr
Definition
(GenBank) ribonuclease R
  KO
K12573  ribonuclease R [EC:3.1.13.1]
Organism
neo  Neorhizobium sp. SOG26
Pathway
neo03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:neo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CYG48_04620 (rnr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:neo03019]
    CYG48_04620 (rnr)
   03016 Transfer RNA biogenesis [BR:neo03016]
    CYG48_04620 (rnr)
Enzymes [BR:neo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     CYG48_04620 (rnr)
Messenger RNA biogenesis [BR:neo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     CYG48_04620 (rnr)
Transfer RNA biogenesis [BR:neo03016]
 Prokaryotic Type
  tRNA degradation factors
   CYG48_04620 (rnr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB S1 CSD2
Motif
Other DBs
NCBI-ProteinID: AXV15042
UniProt: A0A346YKP5
Position
complement(941489..943852)
Genome map
AA seq 787 aa AA seqDB search
MREPQDRSRRQQKRAERAERGAGAASGDKPAIIHGAVPPREVLLEFISENPDKASKREIA
KAFGLKGDTRVELKDLLRTLEEEGLLTKNRKSLTRPGALPPVTVLDITTRDKDGELIGRP
SEWADENGAAPAVLIRQSSENRGKGKTPAAGLNDRVLAKIFPNKDRSGPAYTARVIKVID
KRRGAALGVVHKLADGEIRLLPIDRRGEEMVIDSTDLGEAKDGDLVESEVVRSSRFGLPR
ARVLSVVGSVGSEKAISMIAIYAHGIPHMFPKQVLDEADAAKPATMSKREDWRDLPLITI
DPADAKDHDDAVYAELDPSPDNLDGVIVTVAIADVSWYVRTGSPLDREALKRGNSVYFPD
RVVPMLPERISNDLCSLREGEDRPALAVRMVFSKEGRKASHTFHRIMMKSAAKLSYQQAQ
AAIDGKPDDKAGPLLDTILKPLWHAYGILKRGRDRRQPLELDMPERKILLKPDGTVDRVF
VPERLDAHKLIEEMMIQANVCAAETLEKKRQVLVYRVHDAPSLAKQETLREFLATLGISM
AKGGQMRSNSFNGILSKAEGTPHQVMVNEMVLRSQSQAIYSPDNIGHFGLNLMKYAHFTS
PIRRYADLIVHRALVGSLGLGEGGITPDEEAQLDDIAAEISTFERRAMAAERDTVNRLVA
HHLAERIGEDFEGRVSGVTKAGLFVSLPTYGADGFIPISTLGNDYFIYDEAHQALSGEKS
GLGYQIGDSVEVRLKQAIPLAGALQFEMLSEGKKMPTAVRSFHKSGRRDRSSGRAKPGTR
PPRGRRR
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
gtgagagaaccgcaagacaggtcgagacgtcaacagaagcgcgccgagcgtgctgaacga
ggagccggcgcggcatcgggcgataagcccgcgattatccatggggccgtgccgccgcgc
gaagtcttgctggagttcatctcggagaaccctgacaaggcttcgaaacgcgagatcgcc
aaggctttcgggttgaagggtgacacgcgtgtcgaactgaaggacctgcttcgcacgctc
gaggaggaaggtctcctcaccaagaaccgcaagtcgctgacgcgcccgggcgccctgccc
cctgtcacggtgctcgacatcaccacccgcgacaaggacggcgagctgatcggccggccg
agcgaatgggctgatgagaacggtgctgcaccggcggtgttgatccggcagtcatcggaa
aaccgtggcaagggcaagacaccggccgccggcctcaacgaccgcgtgcttgccaagatc
ttccccaacaaggataggtccggccctgcctatacggcccgcgtcatcaaggtcatcgac
aagcgccgcggcgccgcgctcggcgtcgtgcacaagctcgccgatggcgagatccgcctg
ctgccgatcgatcggcgcggcgaggagatggtgatcgattcaactgatcttggcgaggcc
aaggacggcgatctcgttgagtcggaagtcgttcgttccagccgtttcggcttgccgcgg
gcacgcgtcctgtccgtcgtcggttcagtgggttccgaaaaggcgatctcgatgatcgcg
atctatgcccacggcattccgcacatgttccccaagcaggtgctggacgaagccgatgcc
gccaagccggccaccatgtcgaaacgcgaggactggcgcgaccttccgctgatcaccatc
gatccggcggacgccaaggaccacgacgacgccgtttatgccgaactcgatccgtcgcct
gacaatctggatggcgtcatcgtcacggtcgcgatcgccgatgtctcctggtatgtccgc
accggctcgccgctggaccgcgaggcgctgaagcgcggtaattccgtgtatttcccggac
cgcgtcgtgccgatgctgccggagcgcatctccaacgacctctgctccctgcgtgaaggc
gaggaccgccccgcacttgccgtgcgcatggtcttctcgaaagagggccgcaaggcgagc
cataccttccatcgcatcatgatgaagagcgccgccaagctctcctaccagcaggcccag
gcggcaattgatggaaagccggacgacaaggccggaccgctgctcgacacgatcctgaag
ccgctgtggcacgcctatggcatcctcaagcgtggccgtgaccgtcgccagcccctcgag
ctcgacatgccggagcgcaagatcctgctgaagccagacggcaccgttgaccgcgtcttc
gttccggaacgtttggatgcccacaagctcatcgaagagatgatgatccaggccaatgtc
tgtgctgccgaaacgctcgaaaagaaacggcaggttctggtctatcgcgtccacgacgcg
ccgtcgctcgccaagcaggaaacgctgcgggagtttctggcaaccctcggtatctccatg
gccaagggcggccagatgcgttccaactcgttcaacggtatcctgtcgaaggccgagggc
acgcctcaccaggtcatggtcaatgagatggtgctgcgctcccagagccaggcgatctac
agccccgacaacatcggccatttcggcctcaacctgatgaaatacgcgcatttcacctcg
ccgatccggcgttatgcggacctcatcgtgcatcgtgcgctggtcgggtcgctgggcctc
ggtgaaggtggcatcacgccggatgaagaagcgcagctcgatgacatcgccgccgagatc
tcgaccttcgagcggcgcgccatggccgccgagcgcgataccgtcaaccggctggtggcg
catcatctggcagagcgcatcggcgaagacttcgaaggccgcgtctccggcgtcaccaag
gccgggctgttcgtttccctgccaacctatggggccgatgggttcatcccgatctcgacg
cttggaaacgactacttcatctatgacgaggcgcaccaggcgctctctggcgaaaagagc
gggctgggataccagatcggcgacagcgtcgaagtgcggctgaagcaggcgataccgctt
gccggcgcgctgcaattcgagatgctgagcgaaggcaaaaagatgccgacggcagtccgg
tcgttccacaagtcaggtcggcgtgaccgttcatccgggcgcgctaaacccggcacccgt
ccgccccgcggccgcaggaggtaa

DBGET integrated database retrieval system