KEGG   Neorhizobium sp. SOG26: CYG48_04715Help
Entry
CYG48_04715       CDS       T05626                                 

Gene name
gatB
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
neo  Neorhizobium sp. SOG26
Pathway
neo00970  Aminoacyl-tRNA biosynthesis
neo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:neo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CYG48_04715 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:neo03029]
    CYG48_04715 (gatB)
Enzymes [BR:neo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CYG48_04715 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CYG48_04715 (gatB)
Mitochondrial biogenesis [BR:neo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CYG48_04715 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N
Motif
Other DBs
NCBI-ProteinID: AXV15060
UniProt: A0A346YKR3
Position
960651..962153
Genome map
AA seq 500 aa AA seqDB search
MTIVDVRTPDPKRLIPGATGDWEVIIGMEVHAQVLSKSKLFSGASTEFGKPANSNVSLVD
AAMPGMLPVINEECVKQAVRTGLGLKAAINKRSVFDRKNYFYPDLPQGYQISQFKDPIVG
EGKIVISLGPDRQGQFEDIEIGIERLHLEQDAGKSMHDQHPTMSYVDLNRSGVALMEIVS
KPDMRSSDEAKAYMTKLRSIVRYLGTCDGNMDEGSMRADVNVSVRRPGEPFGTRCEIKNV
NSIRFIGQAIEYEARRQIGILEDGGTIDQETRLFDPNKGETRSMRSKEDAHDYRYFPDPD
LLPLEFDDAFIAELAEHLPELPDDKKARFVRELGLSVYDASVLVSEKAIADYFEAVAEGR
DGKMAANWVINDLLGALNRLGKDIEETPVSPAQLGGIIDLIKAETISGKIAKDLFEIVLN
EGGDPAEIVEARGMKQVTDTGAIEKAVDEIIAANPDQVAKVKAKPTLAGWFVGQVMKSTG
GKANPQAVQALVKAKLGIEE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgactattgtcgacgtccgcacgcccgatccgaaacgcttgattcccggcgccactggc
gactgggaagtgatcatcggcatggaagtgcacgcgcaggtcctgtcgaagtccaagctc
ttttcaggtgcttccaccgaattcggcaagcccgccaattccaatgtatcgctcgtcgac
gcggctatgcccggcatgctgcccgtcatcaacgaggaatgcgtgaagcaggccgttcgc
acggggcttggcctgaaggcagcgatcaacaagcgctccgttttcgaccgcaagaactat
ttctatcccgacctgccgcaaggctaccagatctcccagttcaaggacccaatcgtcggc
gaaggcaagatcgtgatctcgctcggtccggaccgtcagggccagttcgaggacatcgag
atcggcatcgagcgcctgcacctggaacaggatgccggcaagtcgatgcacgaccagcat
ccgaccatgtcctatgtcgacctcaaccgttcgggcgtggcgctgatggagattgtctcg
aagcccgacatgcgctcgtcggacgaagccaaggcctacatgaccaagctgcgctccatc
gtgcgctacctcggaacctgtgacggcaacatggacgaaggctcgatgcgcgccgacgtc
aacgtttccgtacgccgtccgggcgagcccttcggcacgcgctgcgagatcaagaacgtc
aactccatccgcttcatcggccaggcgatcgaatatgaagcgcgtcgccagatcggcatc
cttgaggatggcggcacgattgaccaggaaacccgcctgttcgacccgaacaagggcgag
acgcgttccatgcgctccaaggaagatgcgcacgactatcgttatttccccgacccggac
ctgctgccgctcgaattcgacgatgccttcatcgccgaacttgccgagcacctgccggaa
ctgccggacgacaagaaggcccgctttgttcgcgaactggggctgtcggtctatgacgct
tcggtgctggtttcggaaaaggcgattgccgattatttcgaagcggtggccgaaggccgc
gacggcaagatggccgcgaactgggtcatcaacgacttgctgggcgccttgaacagactt
ggcaaagacattgaagagactccggtttcgcccgcccagcttggcggcatcatcgacctc
atcaaggccgaaaccatctccggcaagatcgccaaggacctcttcgagatcgtcttgaac
gaaggcggcgaccccgcggagatcgtcgaagcccgcggcatgaagcaggtgaccgacacc
ggtgcgatcgagaaggcagtcgacgagatcatcgccgccaacccggatcaggtcgccaag
gtaaaggcgaagcccacgctcgccggctggttcgttggccaggtcatgaagtcgaccggc
ggcaaggcaaatccgcaggccgtccaggcgctcgtcaaggcgaagctggggatcgaggag
tag

DBGET integrated database retrieval system