KEGG   Neorhizobium sp. SOG26: CYG48_08745Help
Entry
CYG48_08745       CDS       T05626                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
neo  Neorhizobium sp. SOG26
Pathway
neo00053  Ascorbate and aldarate metabolism
neo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:neo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    CYG48_08745
Enzymes [BR:neo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     CYG48_08745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_4 NAD_binding_10 adh_short Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AXV15776
UniProt: A0A346YMS9
Position
complement(1768900..1769697)
Genome map
AA seq 265 aa AA seqDB search
MKRLLITGAAGGLGSAMRARLSGQAEILRLSDIVDVGAAGPNEEVVTCDLGDAEAVMKLV
EGCDGILHLGGVSVEDKFSKILNANLLGLFNLYEAARAHGHPRIIFASSNHVVGFYRQDQ
HIDVKAQMKPDGLYGVSKCFGEALASMYFDKFGQETAIVRIGSCFEKPLNHRMLSGWMSY
DDFVSLIGCVFRAPMLGCPIIWGISDNDSKWWDNSHASYLGWRPKDNAERFRAELDATQE
RPAPTSAMAVYQGGKFVEDPIFPED
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgaagagacttctgatcacaggtgcggccggcggcctgggaagcgcgatgcgcgcccgc
ttgtcggggcaggcggagatccttcggctgtccgacatcgtggacgtcggtgctgccggg
ccgaacgaggaagtcgtcacctgcgatctcggtgacgccgaggcggtaatgaagcttgtc
gaaggctgcgacggcatcctgcatcttggcggcgtatcggtggaggacaagttctccaag
attctcaacgccaaccttctggggctcttcaacctctatgaggcagcgcgcgcccatggg
catccgcgcatcatctttgcaagctccaatcacgttgtcggcttctatcggcaggaccag
catatcgacgtcaaggcgcagatgaagccggacggcctttacggcgtctcaaaatgcttc
ggcgaagcgctggcgagcatgtatttcgacaagttcgggcaggaaaccgcgatcgtgcgg
atcggcagctgtttcgaaaagccgctgaaccaccggatgctgtcaggctggatgtcctat
gacgacttcgtgtcgctgatcggctgcgtcttccgcgcgccgatgcttggctgcccgatc
atctggggcatttccgacaatgacagcaagtggtgggataactcgcacgcctcctatctc
ggatggcgcccgaaggacaacgccgagcggtttcgggccgagcttgatgcaacgcaggag
cggccagcgcccacctcggcgatggctgtctaccagggcggcaaattcgtggaagatccg
atctttcccgaggactga

DBGET integrated database retrieval system