KEGG   Neorhizobium sp. SOG26: CYG48_11020Help
Entry
CYG48_11020       CDS       T05626                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
neo  Neorhizobium sp. SOG26
Pathway
neo00260  Glycine, serine and threonine metabolism
neo01100  Metabolic pathways
neo01110  Biosynthesis of secondary metabolites
neo01120  Microbial metabolism in diverse environments
neo01130  Biosynthesis of antibiotics
neo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:neo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CYG48_11020
Enzymes [BR:neo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CYG48_11020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase BES1_N Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AXV16178
UniProt: A0A346YNY1
Position
2209230..2210282
Genome map
AA seq 350 aa AA seqDB search
MFFASDNWAGAHPAINDRLSRESTRFAAAYGNSELDKTVEARFNEIFEREVSVFFVSTGT
AANSLSLASMARTGGVVFAHSEAHVIEDECGAPDFFSGMRMVPVEGAGGKIDPEKLSSRI
AGYPQDSLHHGRAAALTLTQATETGTVYSLDEIDALTAIARKNGLPVHMDGARFANALVA
LGCSPAEMTWKRGVDVLSFGGTKNGCWCAEAIVFFNRDLARDFAFIRKRSAQLFSKTRFI
SAQFEAYLEGDRWLDLARHANTMADRLRAGIRTQNSSRLAWETTSNEVFAVLSKAAATSA
ENKGARFYGWPVPLNQPDLVGSDETLVRLVTSFATTEEDIDQFLAICKAG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgttcttcgcttccgataactgggcaggcgcccatcctgccatcaatgaccgtctgtca
cgtgagtccacccggtttgccgcggcttacggcaacagcgaactcgacaagaccgtcgaa
gcccgcttcaacgaaatcttcgaacgcgaggtatccgttttcttcgtgtccacgggtacc
gccgcgaattcgctgtcgctcgccagcatggcccgcaccggcggcgtcgtctttgcccat
tccgaggcgcatgtgatcgaagatgaatgcggcgcgccggatttcttctccggcatgcgc
atggtgccagtggaaggcgcaggcggcaagatcgacccggaaaaactaagcagccgcatt
gccggttacccgcaggactcgctgcatcacggccgcgccgccgccctcaccctcacccag
gccaccgagaccggcacggtctacagccttgacgagatcgacgccctgaccgccatcgcc
cgcaagaacggcctaccggtgcacatggacggcgcccgctttgccaacgcgctcgtggcg
ctcggctgctcgcccgccgagatgacatggaagcgcggcgtcgacgtgctctccttcggc
ggcaccaagaacggctgctggtgtgcagaagccatcgtcttcttcaaccgggaccttgcc
cgcgactttgccttcatccgcaagcgttccgcacagctgttttccaagacacgcttcatc
tcggcccagttcgaagcttatctcgaaggtgatcgctggcttgatctcgcacggcacgcc
aacaccatggccgaccgcctgcgcgctggcatccgcacccagaacagctcgcggcttgcg
tgggaaacgacgtcgaacgaagtctttgcggttttgagcaaggcggctgccacatcggcc
gaaaacaagggcgccaggttctacggctggccggttccgttgaaccagccggacctcgtc
ggcagcgacgaaacactcgtccgcctcgtcacctcatttgcgacgacggaagaagacatc
gaccagttcctggcgatctgcaaggcaggctga

DBGET integrated database retrieval system