KEGG   Neorhizobium sp. SOG26: CYG48_14520Help
Entry
CYG48_14520       CDS       T05626                                 

Gene name
kynA
Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
neo  Neorhizobium sp. SOG26
Pathway
neo00380  Tryptophan metabolism
neo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:neo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    CYG48_14520 (kynA)
Enzymes [BR:neo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     CYG48_14520 (kynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase IDO Sec7_N YfdX Hs1pro-1_C
Motif
Other DBs
NCBI-ProteinID: AXV17438
UniProt: A0A346YSJ1
Position
2949924..2950721
Genome map
AA seq 265 aa AA seqDB search
MSFRQKMSYTDYLRLDDVLKAQSPLSDAHDELLFIIQHQTSELWMKLAIHEIRSAMDAIR
GDTPQPAFKMLTRVARIFEQLNNAWDVLRTMTPSEYTEFRNSLGQSSGFQSYQYRAIEFL
AGNRNTAMLGPHSHRPDLLASLEEILSRPSLYDEALLLLSRNGFDIGDEANRANWRETRA
ENPKVMEAWRAVYAEPGKHWDLYELAEKLVDFEDYFRRWRFNHVTTVERVIGFKRGTGGT
SGTHYLKKMLEVELFPELWRVRTVL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttccggcagaagatgtcctatacggattatcttcggctggacgacgtactgaag
gcgcagtcgccgctctcggatgcgcatgacgagctgcttttcatcatccagcaccagacg
tcggaactgtggatgaagcttgccatccacgagattcgctcggccatggatgcgatccgt
ggcgacacaccgcagccggcattcaagatgctgacgcgcgtcgcccgcatcttcgaacag
ctcaacaacgcctgggacgtgctgcgcaccatgacgcccagcgagtataccgagttccgc
aactcgcttggccagtcctccggtttccagtcctaccagtaccgagcgatcgaattcctg
gcaggcaatcgcaatacggcgatgctcgggccgcattcgcatcgtcctgatctgctggcc
tcgcttgaagagatcctgtcgcgcccgagcctttatgacgaggcgctgctgcttctgtcg
cgcaacggctttgacatcggcgacgaggcaaaccgggcgaactggcgcgagacgcgcgct
gaaaatccgaaggtcatggaggcgtggcgggcggtctatgccgaacccggcaagcactgg
gacctctatgagctcgcagagaagctggtcgacttcgaagactatttccgtcgctggcgc
ttcaaccacgtgacgacggtcgaacgggtgatcggcttcaagcgcggcaccggcggcacg
tccggcacccactatctcaagaaaatgctcgaagtcgagctattccccgaactttggcgt
gtgcgcacggtgctttag

DBGET integrated database retrieval system