KEGG   Nanoarchaeum equitans: NEQ051Help
Entry
NEQ051            CDS       T00152                                 

Definition
(GenBank) NEQ051
Organism
neq  Nanoarchaeum equitans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 FAD_binding_8 NAD_binding_6
Motif
Other DBs
NCBI-ProteinID: AAR38906
UniProt: Q74N60
Position
complement(45112..45753)
Genome map
AA seq 213 aa AA seqDB search
MKVKILKREFIDKDHYLLWVERPKDYNYKPGQFTYIESTINNNKVRRFYSFASHPEEENL
LFYIKRVPNGLMSNYLAEIPLGSTIEIGNPMGHFTLDRADTDRVIFIGAGTGIAPIRPLT
IEAVKQNKKVIVVHQERYKHLLVFRDLFEQLPIIYIPILSKEQSEYHGHVQDYIDRLIYN
DATYYICGSRQFVIEIANLLKSKGINKIVIEAF
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttaaaatattaaaaagggaatttatagataaagaccattatttgctatgggta
gaaaggcccaaagattataattacaaaccggggcaatttacatatattgaaagtacaata
aacaataacaaggtaagaaggttttattctttcgcttcccacccagaagaagaaaaccta
ttgttttacattaaaagagtacccaatggtttgatgtccaattatttagctgaaatacca
ttaggttcaacaatagaaataggtaaccccatgggacatttcactttagatagggcagat
acggatagagttatttttataggggctggcacaggtatagccccaataaggccattaact
attgaagcggtgaaacaaaataaaaaagttattgttgtacaccaagaaaggtataagcat
ttgttagtttttagagatttgtttgaacaattgcctataatatatattcctatattatct
aaagaacaatccgaataccatgggcatgtacaagattacatagatcgcctaatatataat
gatgcaacctattatatatgtgggtcgagacaattcgtaatagaaattgctaacctatta
aaaagcaaaggcataaataaaatagtaattgaagctttctaa

DBGET integrated database retrieval system