KEGG   Nanoarchaeum equitans: NEQ460Help
Entry
NEQ460            CDS       T00152                                 

Definition
(GenBank) NEQ460
  KO
K07178  RIO kinase 1 [EC:2.7.11.1]
Organism
neq  Nanoarchaeum equitans
Brite
KEGG Orthology (KO) [BR:neq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:neq01001]
    NEQ460
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:neq03009]
    NEQ460
Enzymes [BR:neq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     NEQ460
Protein kinases [BR:neq01001]
 Serine/threonine kinases: Other
  RIO family [OT]
   NEQ460
Ribosome biogenesis [BR:neq03009]
 Eukaryotic Type
  Pre-40S particles
   Kinases
    NEQ460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RIO1 APH FTA2 Pkinase Kdo Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AAR39304
UniProt: Q74MY7
Position
408446..409198
Genome map
AA seq 250 aa AA seqDB search
MKEEWKVFRGFLDNYTLKNLAKLESSGYLDSLEYIVAEGKESVVIKGKYEDNDIAIKIYR
VMNINWKDFHRYLRQDRRFKGIRWSRVEIINEWVRREYSNLMRAYKYGINVPRPIFYRGN
VLAMEFIGDQYPAPKLKDIDFDEQSINKVKENLSKDLELLVKKAKIVHGDLSPFNILYYR
EKPYIIDVSQAIPIDSPEAINLLKRDFSNINFFLKKYGLSLDSTLLDDLILFIKRKTSND
IELFTKPGLP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggaatggaaagtctttagaggttttctagataattatactttaaaaaattta
gccaaactagaaagctctggttatttggatagcttagaatatattgttgcagagggtaag
gaaagcgtagtaattaaaggaaaatacgaagacaacgatatcgctataaaaatttataga
gtgatgaacataaattggaaagattttcatcgctatctaagacaggatagaaggtttaag
ggcattagatggagtagagtagaaataattaacgaatgggttagaagggaatattctaat
cttatgagagcttacaagtatggtattaatgtgccaagaccaatattttataggggcaat
gttttagcaatggaatttattggcgatcaatatccagcacctaagctaaaagatatagat
tttgatgaacaatctataaataaggttaaagagaacctatctaaagatttggaattgtta
gttaaaaaagccaaaatagtgcatggcgatttaagcccattcaatattttatactatagg
gaaaaaccctatataattgatgtttctcaagcaattccaatagattcgccagaagcaata
aacttattaaaaagggatttttctaatataaacttctttctaaagaaatatgggctttct
ttggatagtactttattagatgatctaatattattcataaagagaaaaaccagtaatgat
atagagctatttactaaaccaggattgccttaa

DBGET integrated database retrieval system