KEGG   Nitrosomonas eutropha: Neut_0073
Entry
Neut_0073         CDS       T00393                                 

Definition
(GenBank) conserved hypothetical protein
Organism
net  Nitrosomonas eutropha
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-ProteinID: ABI58361
UniProt: Q0AJW0
Position
complement(72484..73989)
AA seq 501 aa
MTLFTTDYLEYYLTLVGWIVHNGIWSVLVASGVFAIPFIAIILPEWLKARGEGADEGNKG
LLSAARIETRVWVAVVVVLFAGIPFIDVDLSRVRFDDARSRQCGVSVPQPSDTGWSQSFT
TINDQSAKVPVWWAFMHALSRGLTSASVAAIPCGTELRQMRMEIDATRIDDPVLAQEVSD
FSHDCYGPARAKLFMSRPELDEAQMHDVTWIGSRYFVASAGYYDTYRSRTPRDAWPYDSG
RDAGLAQVPSGGGYPTCRQWWSDGSDGLRMRLLSQVDSSLLNRVASWAGFLSRNEVDDSV
IRAIAAPRQQKLNQGAVYTDYGGQIDKTAPNIVTRAASDLGITIGSIGFFPAMDVVRQAL
PMVLSFLKMALVICIPLVLIISTYELKAVVTVSVVQFALFFVDFWFQLARWIDSTILDAL
YGRGWGWNRPVTNFDPLMGLNNSFGDMLLNFVMATMFLILPAFWIAALAWAGVRAGNIAQ
MMATSTDGAKAAGSKAANKVV
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgacgctattcacgaccgattacctggagtattacctgacgctggtgggctggattgtg
cacaatggcatctggtcggtgttggtggccagcggcgtgtttgccattcccttcattgcc
atcatcctgccggaatggctcaaagcccgaggcgagggcgccgacgagggtaataagggt
ctgctgtcggcggctcgtattgaaacccgagtgtgggtggcggttgtcgtggtgctgttt
gccggcattccgttcatcgatgtggatctgagccgggtgcgctttgacgatgcccgctcc
cgtcaatgcggagtgagcgtaccgcagccctccgatacgggctggagccagtccttcacc
accatcaacgaccaaagcgcgaaagttcccgtctggtgggcatttatgcacgcgctctca
cgtggcctcaccagcgcctcggtcgcagcgattccatgcggtactgaactacggcaaatg
cgcatggagatcgacgccacacgcatcgatgacccggtgctggctcaagaggtatcggac
ttctcacacgactgctatggcccggcccgcgccaagctgtttatgagccgcccagaactg
gatgaagcgcagatgcatgatgtcacctggattggttcacggtattttgtggcctcggcg
ggttactacgacacctaccgttcacgcaccccgcgcgacgcctggccgtatgatagtggt
cgcgatgcggggctggcccaggtacccagtggcggcggttaccccacctgccggcagtgg
tggagcgatgggagtgacggtctgcggatgcgcctgctgtcccaggtcgattccagcttg
ctcaatcgcgtagccagttgggccggttttctgagccgcaatgaggtggacgactcggtg
atccgtgcgatcgccgcgccgcgccagcaaaaacttaaccagggggctgtctataccgac
tacggtgggcagatcgataagacagcgccaaacatcgtgacccgtgccgccagtgacctc
ggcatcacgattggctcgatcggttttttcccggccatggatgtggtgcgccaggcgctg
cccatggtgttgtcgtttctgaagatggcgctcgtgatctgcatcccgctggtgctcatt
atcagtacctacgagctcaaggccgtggtaactgtcagcgtggtgcagttcgctctgttc
tttgtggatttctggtttcagcttgcacgttggatcgacagcacgattctggatgcgctc
tatgggcggggctggggatggaatcgacccgtcaccaactttgatccgctgatggggttg
aacaacagctttggcgatatgctgctgaacttcgtgatggcgacgatgtttctgatatta
cctgccttttggattgcagcgctcgcgtgggccggagtgcgggctggtaatattgcccag
atgatggctacctcaaccgatggggccaaggccgcgggaagcaaagccgccaataaagta
gtctag

DBGET integrated database retrieval system