KEGG   Nitrosomonas eutropha: Neut_0076
Entry
Neut_0076         CDS       T00393                                 

Definition
(GenBank) protein of unknown function DUF1527
Organism
net  Nitrosomonas eutropha
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: ABI58364
UniProt: Q0AJV7
Position
complement(75762..76694)
AA seq 310 aa
MNLPHLRFGVAMALLLAATSSFALNTATIVASTLSPSCLEYRVVGICYWLSCGVGGCRIR
TSIKVRHYVPDAVVSSYSNTGANPWVEVRPMSLPNPTAQAGGDGTTNDDHENNLAKFKNS
DVIGHPGGEVFNEFVAGSGYFCQGAGTAFVPYLLSTLDTLAWRYNVPEAVYPESLIPGQR
EVGSRSDMNLWGNVYPRGGFLHQTDDYKAGAIVAQRAGDVVTRRGQLHVYQPLLASSRAG
YWPAGALIEGDASTGKWQELTPRLSNTCTVFPHNETLTQAKQGDYAWVLWRPYSCCQRRG
QTFLGSVDFN
NT seq 933 nt   +upstreamnt  +downstreamnt
atgaatttgccccacctgcgattcggtgtcgccatggcgctcttgcttgcggcgacatcc
agcttcgcgctcaacaccgccaccattgtggcttccactttgtctccatcctgtctggaa
taccgtgtggtcggcatctgctactggctgtcctgcggagtgggcggttgccggatacgc
acctccatcaaggtgcgccactacgtcccggacgcggtggtgtcgagctattcaaacact
ggcgcgaacccctgggtggaagtacggcccatgagcctgcccaatcccacagcgcaggcc
ggtggcgacggcacgaccaacgacgatcacgagaacaatctcgccaaattcaagaatagc
gacgtgatcggtcatcccggtggggaagtgttcaacgaattcgtcgcgggttctgggtat
ttctgccagggagcaggcacagcctttgtgccgtacttgctcagcaccttggacacgctg
gcctggcgctacaacgtgccggaggccgtataccccgagtcgctcattcccggccagcgt
gaagtgggttcgcgcagcgacatgaatctgtggggcaacgtttacccacgcggcggcttc
ttgcaccagaccgatgactacaaggcgggagccatagtggcccagcgtgcgggcgacgtc
gtgacccgccgggggcaactgcatgtgtatcagccgttgcttgccagttctcgggcgggc
tactggcctgcgggtgcattaatcgagggcgatgcctcgaccggtaagtggcaggagctc
actccgcgtctgtccaacacatgcacggtgttcccccataacgagacgctaacgcaggcc
aagcaaggcgactacgcctgggtgttgtggcgtccgtatagctgctgccagcgccgtggg
cagaccttcctgggcagtgtggattttaattga

DBGET integrated database retrieval system