KEGG   Nitrosomonas eutropha: Neut_0088
Entry
Neut_0088         CDS       T00393                                 

Definition
(GenBank) putative secreted protein
Organism
net  Nitrosomonas eutropha
SSDB
Motif
Pfam: DUF3450 Macoilin Golgin_A5 Fez1 Filament CENP-F_leu_zip OmpH MIF4G_like_2
Other DBs
NCBI-ProteinID: ABI58376
UniProt: Q0AJU5
Position
complement(87845..89242)
AA seq 465 aa
MRSNGLLKWLMIPVALLVLFAGIRLLSGGDTTRSGAAGSGSQLTPEEMQALGIEGDTPHD
TVATLVAQVKQMRTELQTAQADNKTQRSENARLRQRETAIDQRINSALESERSTLQRDQA
KLANERQQTEGLLQDLQRRLESLGNTDLPVGLGLREGDADGFGAGAGIRWIEPDDAQQVD
GRNRSSSLSFPTSFGPAQKTLETTVGRVADAGAKAAGVSSAKAVYTVPTNSTLMGSVAMT
ALIGRVPIDGTVNDPYPFKVIVGPDNLTANGIDIPDVAGAVFSGTASGDWTLSCVRGQVR
SITFVFHDGTIRTIPKDSERNNQRNNQEDGLGWISDPFGIPCVSGDRRSNAQQYLGTQAL
ITAAGAGAASLIDSDSGRMSYVGADGSIGTTGITGNEAMGQILAGGVRDMSQWVNKLYGQ
AFAAVYVQPGAKVAVHLEKPLAIDYEPQGRRVDHRIGEAHALELD
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgcgcagtaacggacttctcaagtggctgatgattccggtggccctactggtgcttttt
gcgggtatccgcctgctatccggtggcgacacgacccgttcaggcgctgcgggttccggc
agtcagctcacgcccgaagagatgcaggcgctgggcatcgagggcgatactccgcacgat
actgtggcgacgctcgtggcgcaggtcaagcagatgcgcaccgaactgcagacggcgcag
gccgacaacaagacacaacgcagcgagaacgcgcgtctgcgccagcgcgagaccgccatt
gaccagcgcatcaattccgcactggagtcggaacgcagcaccctgcaacgcgaccaggcc
aagcttgccaacgaacgccagcagaccgaaggtttgttgcaggacttgcagcgccgtctg
gaaagtctcggtaataccgatctgcccgtcggtctgggtctgcgcgagggggatgcggat
ggctttggggcaggtgccggtatccgctggattgaaccggatgatgcccagcaggtcgat
ggccgcaatcgcagcagtagtctgagttttccaacgagtttcggccccgcgcaaaagaca
ctggaaaccaccgtcggccgcgtggccgacgccggtgccaaggctgccggggtgagctcc
gccaaggcggtctatacggtgccgaccaactcaactttgatgggctcagtcgccatgacg
gcgttgattggccgcgtgcccatcgacggtacggtcaacgatccgtatcccttcaaggtc
attgtcgggccggacaatctgaccgccaacggcatcgacattcccgatgtggcgggggct
gtgttcagcggcaccgcctcgggcgactggacgttgtcatgtgtgcgcggacaggtgcgc
agcatcacgtttgtctttcatgacggtacgattcgcaccatccctaaagacagcgagcga
aataatcagcgcaacaaccaggaggatggcctgggctggattagcgacccgttcggtatt
ccttgcgtgtcgggcgatcgacgcagcaatgctcagcagtacttgggtacgcaggctttg
attaccgccgccggtgcgggcgcggcatcgctcatcgattcagacagcggacggatgtcc
tacgtgggggccgacggatcgattggcaccacaggcattaccggcaacgaggccatgggt
cagattctggccggtggcgtgcgggacatgtcgcagtgggtcaacaagctctacggtcaa
gccttcgccgctgtgtatgtacagcccggcgccaaggtggccgtccatctggaaaaacct
ctggccatcgattatgagccgcaagggcgccgggtcgatcaccgtataggagaagcccat
gcgcttgaactcgattaa

DBGET integrated database retrieval system