KEGG   Nitrosomonas eutropha: Neut_0094Help
Entry
Neut_0094         CDS       T00393                                 

Definition
(GenBank) hypothetical protein
Organism
net  Nitrosomonas eutropha
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Plasmid_RAQPRD
Motif
Other DBs
NCBI-ProteinID: ABI58382
UniProt: Q0AJT9
Position
complement(91822..92193)
Genome map
AA seq 123 aa AA seqDB search
MVLSIRCRAVHGGVSLLLTAVLAVPLAAHADVPAQRQDLAAVLRQLDALERFVAHSAAAT
PIVPGDRYHFDYPRLLADLARVRTGIQSHLTPSRAQPRDLTELAGDYRSERAPQHNPLPQ
AQP
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctcgattcggtgtcgcgccgtgcacggcggcgtgtctctcctgctcacagcg
gtcttggccgtgccgcttgcggctcacgccgatgtgccagctcagcggcaagacctggct
gcggtcttgcgccaacttgatgcgttggaacgattcgtggcacacagtgcagcggccacg
cccatcgtgccgggtgatcgttaccacttcgactatccgcgcttgctggccgacctggcc
cgtgtgcgtaccggcattcagtctcatctcaccccatcgcgcgctcaaccgcgggatctt
accgagttggcgggggattaccgtagtgagcgtgcgccccagcacaacccgttgccgcag
gcccagccatga

DBGET integrated database retrieval system