KEGG   Nitrosomonas eutropha: Neut_0563Help
Entry
Neut_0563         CDS       T00393                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
net  Nitrosomonas eutropha
Pathway
net03010  Ribosome
Brite
KEGG Orthology (KO) [BR:net00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Neut_0563
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:net03011]
    Neut_0563
Ribosome [BR:net03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Neut_0563
  Bacteria
    Neut_0563
  Archaea
    Neut_0563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Zot
Motif
Other DBs
NCBI-ProteinID: ABI58836
UniProt: Q0AIJ0
Position
583178..583510
Genome map
AA seq 110 aa AA seqDB search
METSVVLRSVRLSAQKGRLVVNQIRGLQVDQAIKLLTFSPKKGAVIILKLLESAVANAEH
NEGADIDELKVARVFIGQGSSLKRVSPRAKGRGNRISKPTCNIFLTVCNR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaacatctgtagttttacgtagcgttagattatccgctcaaaaagggcggttagtg
gtaaatcaaattcgaggattgcaggttgatcaggctattaagctcttgacattcagtccc
aagaagggggcggtaattattttaaagttacttgagtcagcagtagcaaatgcggagcat
aatgaaggtgctgatattgacgaattaaaagtagctcgagtttttatagggcaaggatct
tcactaaaacgtgttagtccgcgcgcaaaagggagaggaaatcgtatatcaaaaccaaca
tgtaatattttcttgaccgtctgcaatagatag

DBGET integrated database retrieval system