KEGG   Nitrosomonas eutropha: Neut_0610Help
Entry
Neut_0610         CDS       T00393                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
net  Nitrosomonas eutropha
Pathway
net00071  Fatty acid degradation
net00280  Valine, leucine and isoleucine degradation
net00310  Lysine degradation
net00362  Benzoate degradation
net00380  Tryptophan metabolism
net00620  Pyruvate metabolism
net00630  Glyoxylate and dicarboxylate metabolism
net00640  Propanoate metabolism
net00650  Butanoate metabolism
net00900  Terpenoid backbone biosynthesis
net01100  Metabolic pathways
net01110  Biosynthesis of secondary metabolites
net01120  Microbial metabolism in diverse environments
net01130  Biosynthesis of antibiotics
net01200  Carbon metabolism
net01212  Fatty acid metabolism
net02020  Two-component system
Brite
KEGG Orthology (KO) [BR:net00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Neut_0610
   00630 Glyoxylate and dicarboxylate metabolism
    Neut_0610
   00640 Propanoate metabolism
    Neut_0610
   00650 Butanoate metabolism
    Neut_0610
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Neut_0610
   00072 Synthesis and degradation of ketone bodies
    Neut_0610
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Neut_0610
   00310 Lysine degradation
    Neut_0610
   00380 Tryptophan metabolism
    Neut_0610
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Neut_0610
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Neut_0610
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Neut_0610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:net04147]
    Neut_0610
Enzymes [BR:net01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Neut_0610
Exosome [BR:net04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Neut_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABI58882
UniProt: Q0AD38
Position
complement(620866..622044)
Genome map
AA seq 392 aa AA seqDB search
MRNVVILSGTRTAIGDYGSALKDLAPTTLAAITIKEAIARADIDPASIGHLFAGHVIPTE
ARDMYLARVAALEAGLPQHVAALTLNRVCGSGLQAIISAAQAVQLGDTDVAIAAGVESMS
RGGYLLPALRWGQRMHDSIATDMMVGALTDPFDQVHMGITAEHIAKKWRITREQQDQFAL
ESHQRTIHAIHSGYFREQIVPVEVSSRKGTVIFDTDQHPRDNISMETLGKLHPVFRENGT
VTAGNASGINDGAAALVLMEEHAATQNNHQPMARLVAYGHAGVDPRYMGIGPVPAVKQAL
NRAGLKLTDIDVIESNEAFAVQACAVARELGFDPDRTNPNGGAVALGHPIGASGCILTIK
AIYELQRINGRHALVTLCIGGGQGIAAIFEKY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacgttgtcattctgagtggcacaagaaccgcaatcggtgattacggcagcgca
ctgaaggatctggcgcccaccacgctggccgccatcacgattaaagaggccatcgcccgt
gccgatatagatcccgcaagcatcggacacctgtttgccgggcatgttatccccactgaa
gcacgggatatgtatctggcacgcgtggcggcgctggaagctggtctgccacagcatgta
gcggcacttactctgaaccgggtttgcggcagtggattgcaggcgattatctctgctgcg
caggcggtgcagttgggagataccgatgtggctattgctgccggcgttgagtcgatgagc
cgtggcgggtatctgttgcccgcactgcgctggggacagcgtatgcatgacagtatcgca
accgacatgatggtaggcgccctgaccgatccgtttgatcaggtgcacatggggatcacc
gctgaacacatcgctaaaaaatggcgtattacccgcgagcagcaagatcagtttgccctg
gaaagccatcagcgtactattcacgctattcatagcggctatttccgggaacagatcgtg
ccggttgaggtttccagtcgtaaaggtacggtaatattcgatacagaccagcatccacgc
gacaacatcagtatggaaacactgggaaaactgcacccggttttccgggaaaacggcaca
gtcacggccggtaatgcatccggcatcaatgatggtgcggccgcactggtgctgatggaa
gaacatgcagccacacaaaacaatcatcaaccgatggcacgtctggttgcttacggccat
gccggagtagatccacgttatatgggaatcggcccggtaccagcggttaagcaagcgctg
aatcgtgccggattgaagctgactgatatagatgtaatcgagtccaatgaagcctttgcc
gtccaggcatgtgcggttgcccgggaactgggtttcgatccggatagaaccaacccgaac
ggcggtgccgtggcactggggcatccgattggtgcatccggttgtatactgacgatcaaa
gccatttatgagctgcagcgcataaatggccgccatgcactggttaccctgtgcatcggt
ggtggacagggaatcgctgcaatttttgaaaaatactga

DBGET integrated database retrieval system