KEGG   Nitrosomonas eutropha: Neut_0698Help
Entry
Neut_0698         CDS       T00393                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
net  Nitrosomonas eutropha
Pathway
net00040  Pentose and glucuronate interconversions
net00052  Galactose metabolism
net00500  Starch and sucrose metabolism
net00520  Amino sugar and nucleotide sugar metabolism
net01100  Metabolic pathways
net01130  Biosynthesis of antibiotics
Module
net_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Neut_0698
   00052 Galactose metabolism
    Neut_0698
   00500 Starch and sucrose metabolism
    Neut_0698
   00520 Amino sugar and nucleotide sugar metabolism
    Neut_0698
Enzymes [BR:net01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Neut_0698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABI58970
UniProt: Q0AI62
Position
702998..703885
Genome map
AA seq 295 aa AA seqDB search
MSVVKKAVFPIAGLGTRFLPATKASAKEMLPVVDKPLIQYAVEEAYAAGIRHMIFVTGRT
KRSVEDHFDTAYELENELELAGKTMLLDVARGIAPDDMVCTYVRQSRAMGLGHAVLCSKE
LVGHEPFAVLLADDLMIGKPTVMAQMVEQFAKRQASILAVQDVPREHTRRYGIVSGRSVA
PDLVDVSGIIEKPAPDVAPTTLAVAGRYVLTPGIFKELENMPHGVGGEIQLTDGIARLLQ
HEKVFAYRYKGVRYDCGSKLGFLQATVDLGECHDEVGAEFSAWLQQRDVHLKADN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtagtaaaaaaagctgtattcccgatcgcaggtcttggcacccgctttctacct
gcaaccaaggcatctgccaaagagatgttaccagtcgtagataaaccgttaattcaatat
gccgttgaagaggcgtatgctgccggaatccgacacatgatttttgtgacaggccgcacc
aagcgtagcgtcgaagatcatttcgatacggcctacgagctggaaaatgagttggagttg
gcaggcaagaccatgttgctggatgtcgctcgcggtattgctcccgatgatatggtctgc
acctatgtacgtcaatcccgtgcgatggggcttggtcatgcggtgctgtgctcaaaagag
ctggttggtcatgaaccctttgcagtattactcgctgacgatttaatgattgggaagcct
acggtaatggcgcagatggttgagcaatttgccaaaaggcaagccagcatcctggctgtt
caggatgtaccacgtgaacataccaggcgctacggaatcgtcagcggccgtagtgtggcg
ccagaccttgtggacgtcagcggaattattgagaagcctgctccagatgttgcgcctaca
acgctggccgttgctggtcgctatgttttgaccccgggtatttttaaagagctggaaaac
atgcctcacggtgtcggtggcgaaattcagctcactgacggtattgcccgacttttgcaa
cacgagaaggtttttgcttatcgctacaaaggtgttcgttacgattgtggaagcaagctg
ggatttttgcaggcaacagtggatcttggcgagtgccacgatgaagttggggccgaattt
tcagcatggctgcaacaacgcgacgtacatttgaaggctgataattaa

DBGET integrated database retrieval system