KEGG   Nitrosomonas eutropha: Neut_0864Help
Entry
Neut_0864         CDS       T00393                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
net  Nitrosomonas eutropha
Pathway
net00260  Glycine, serine and threonine metabolism
net00750  Vitamin B6 metabolism
net01100  Metabolic pathways
net01110  Biosynthesis of secondary metabolites
net01120  Microbial metabolism in diverse environments
net01230  Biosynthesis of amino acids
Module
net_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Neut_0864
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Neut_0864
Enzymes [BR:net01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Neut_0864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABI59127
UniProt: Q0AHQ5
Position
complement(881388..882818)
Genome map
AA seq 476 aa AA seqDB search
MRYLSTRGGMLPKTFTEILLGGLAPDGGLAMPESYPKISPAELESWRSLDYPSLAFEILS
RFMDDIPADDLRTLITRTYTDEIFGSEEVTPVQTLESNLHLLHLSNGPTLAFKDIAMQFL
GNLFEYVLAKNNDELNILGATSGDTGSSAEYAMRGKRGIRVFMLSPYGKMSAFQTAQMFS
LQDNNIFNIAIEGVFDDCQDIVKTVSNDQVFKQKYRIGAVNSINWARIAAQIIYYFKAYF
AVTRSNGEAVSFSVPSGNFGNIFAGHVARMMGLPIKQLILATNENDVLNEFFRTGLYRPR
TTTETKQTSSPSMDISKASNFERFIFDLTGRDAARIKELWKLVDQGGSFDLSDTDLWKKI
RDFGIISGTSNHAERITTIRKIHHKFNILIDTHTADGLKVGMELREPDVPLICLETALPV
KFADSIQEAVGFVPEQPDGYDNLEKLPQRFERMTADAEQVKRFIAHQVGPSNQMHG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatctctcgacccgaggcggcatgctgcccaaaacatttactgaaattctgtta
ggcggactggctccggatggcgggctggccatgcctgaatcttatcctaaaatcagcccg
gcagagcttgaatcctggcgctcgcttgactacccgtcgcttgcatttgaaattctgtcg
cgttttatggatgacatccccgccgacgatttgcgcaccttaattacacgcacctatacg
gacgaaatttttggcagtgaggaggtcactcctgtccagacactggaatccaatctgcac
ctgctgcacctgtctaatggccctaccctggcgttcaaggacatcgccatgcagttcctg
ggcaacctgttcgagtatgtgcttgcaaaaaataatgatgaattgaatatcctgggcgca
acttctggtgataccggctccagtgcagaatatgccatgcgcggcaaacggggcattcgc
gtattcatgttgtcaccttacggaaaaatgagtgcttttcagaccgcacaaatgttctcg
ttacaggataacaacattttcaatattgctatcgaaggtgtatttgatgattgccaggat
attgtcaaaactgtcagtaacgaccaggtattcaagcaaaaataccggatcggtgcggtc
aattcgatcaactgggcgcgtatcgccgcgcaaattatctattacttcaaggcctatttt
gcagttacccgctctaacggggaagcagtatctttttcagtcccttccggcaacttcggc
aacatttttgccggccatgtcgcccgtatgatgggcctacccatcaagcaactgattctg
gcaactaatgaaaatgatgtgctgaatgagttttttcgtaccggtttatatcgtccccgc
acaacaactgaaacgaagcaaaccagcagcccttcaatggatatctccaaagcatcaaat
tttgagcggtttatcttcgatctgaccggtcgggatgcggcacgcatcaaagaactctgg
aaattggttgatcaaggaggatcattcgatctttccgatactgatctatggaaaaaaatc
agggattttggcattatttctggaaccagcaaccatgctgaacgcatcaccactattcga
aagatacaccataaattcaatatcctgattgacacacacacagcagatggcctgaaagtg
ggtatggaattgcgcgaacctgatgttccactcatctgcctggaaacagcactgccagtc
aagtttgcggacagtatccaggaagcagtcggattcgtaccggaacaaccggatggatac
gataacctggagaaactgccccagcgttttgaacgtatgacagcagatgccgaacaagtt
aaacggttcattgcccatcaggttgggccatcaaatcagatgcacggataa

DBGET integrated database retrieval system