KEGG   Nitrosomonas eutropha: Neut_1038Help
Entry
Neut_1038         CDS       T00393                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
net  Nitrosomonas eutropha
Pathway
net00860  Porphyrin and chlorophyll metabolism
net01100  Metabolic pathways
net01110  Biosynthesis of secondary metabolites
net01120  Microbial metabolism in diverse environments
Module
net_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Neut_1038
Enzymes [BR:net01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Neut_1038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABI59294
UniProt: Q0AH88
Position
1076046..1076828
Genome map
AA seq 260 aa AA seqDB search
MALDRLAGKSILITRPLHQAGNLAARIKGLGGEPWLFPVLEISDSENKQPLLDMIARLDD
FDLAVFVSPNAVERVMPLVHAERRWPEHVRVATVGKGSARALEHHGIPAVIVPEDGSDSE
ALLRVPQLQIMQGKRIIIFRGNGGRKLLGDTLRDRGASVDYVECYRRHRPEVDPLPLLKY
WHDNGIQAVVISSSEGLDNLFDMIGKTGQQLLRATAVFTAHDRIECKARELGIRKIYRTP
LGDEGTVQGLLEYFEKIQSH
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
ttggcacttgatcggttagccggtaaaagtattctgattacccgccctttgcatcaggcg
ggtaatctggctgcacgaatcaaggggttgggcggagagccatggttgttccccgtgctg
gagatttctgatagcgaaaacaagcagccgttactggatatgattgcgcggcttgatgat
tttgatctggctgtttttgtcagcccgaatgcggtggaaagagttatgccgctggttcat
gcagagcgccgctggcctgagcatgtacgtgttgcaaccgtgggaaaggggagtgcccgg
gcgctcgaacaccatggtattcccgctgtcattgttccagaagatggttctgatagcgaa
gccttgttgcgcgtgccacaactgcagatcatgcagggtaagcgcatcataatttttcgc
ggtaatggcgggcggaaattgcttggggatacgctacgtgatcgtggcgccagtgttgac
tatgttgaatgctatcgtcgccaccggccggaggttgatcccttgccgttgctgaagtac
tggcatgataacgggatccaggcagtagtcatcagcagcagcgaaggtctggataattta
tttgacatgatcggtaaaacaggccaacaattgctcagagctaccgccgtgtttacggca
catgaccggattgagtgcaaggcaagagagctgggtatcaggaagatataccgcactcct
ctcggagatgaagggactgtgcaaggtttgttggagtacttcgaaaaaatacagtcacac
tga

DBGET integrated database retrieval system