KEGG   Nitrosomonas eutropha: Neut_1264Help
Entry
Neut_1264         CDS       T00393                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
net  Nitrosomonas eutropha
Brite
KEGG Orthology (KO) [BR:net00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Neut_1264
Enzymes [BR:net01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     Neut_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ABI59516
UniProt: Q0AGL6
Position
complement(1321090..1321953)
Genome map
AA seq 287 aa AA seqDB search
MSTSINVELTTSPSSGVDSKVRVAAVQMASGPSVTANLEEAFRLIEEAATKGAQLVALPE
YFCIMGMKDTDKLAVRENPGEGEVQNFLSETAKRFGIWLAGGSVPLVSPLSNKVYNSCLV
YDEQGRQVARYDKIHLFGLSLGNENFAEERTIDAGNRVVAIDSPFGRMGLSICYDLRFPE
LYRMMGKVDIILAPAAFTAITGKAHWETLIRARAIENQAYLIAPAQGGFHVNGRETNGDS
MIVDPWGVIIDRLPRGAGVVLAEIDRVYQSSVRASLPALEHRCLLAC
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactagtataaatgttgaattgactacttctcccagttcaggtgttgattccaaa
gtacgggtggcagccgtacagatggcctctggtcccagtgtaacagccaatcttgaggaa
gcttttcgtctgattgaagaggctgctacaaagggtgcgcaactggtggcattaccggaa
tatttctgtatcatgggaatgaaggataccgacaagctggcggtacgtgagaatcctgga
gaaggggaagtccagaattttctgagtgaaactgccaagcggtttggtatctggttggca
ggggggtcagtacctttagtttcacctctttccaataaagtatacaacagctgtctggta
tacgatgaacaaggtcggcaggtggcacgatacgataagatccacttgtttggactgtca
ctgggtaacgagaatttcgctgaggaaagaacgatagacgcaggtaatcgggtggttgca
attgattctccctttggccgtatggggttgtccatttgctacgatctgcgttttcccgag
ctataccgcatgatgggtaaagtggatatcattttggcacctgctgcgtttaccgccatt
accggaaaagctcactgggagacgcttattcgagctcgtgcgattgagaaccaggcttat
ctgattgcgccagcgcagggaggattccatgtgaacggacgtgaaaccaatggtgacagt
atgattgttgatccatggggagtaatcattgatcgtcttccgcgcggggccggagtagtg
ctcgcagaaatcgatcgcgtatatcagtcaagtgtacgagcgagcctgcctgcactggaa
catcggtgcttgcttgcctgctga

DBGET integrated database retrieval system