KEGG   Nitrosomonas eutropha: Neut_2485Help
Entry
Neut_2485         CDS       T00393                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
net  Nitrosomonas eutropha
Pathway
net00020  Citrate cycle (TCA cycle)
net00190  Oxidative phosphorylation
net00650  Butanoate metabolism
net01100  Metabolic pathways
net01110  Biosynthesis of secondary metabolites
net01120  Microbial metabolism in diverse environments
net01130  Biosynthesis of antibiotics
net01200  Carbon metabolism
Module
net_M00009  Citrate cycle (TCA cycle, Krebs cycle)
net_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
net_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Neut_2485
   00650 Butanoate metabolism
    Neut_2485
  Energy metabolism
   00190 Oxidative phosphorylation
    Neut_2485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF3098 SecE CbtB DUF1129
Motif
Other DBs
NCBI-ProteinID: ABI60692
UniProt: Q0AD90
Position
2613244..2613597
Genome map
AA seq 117 aa AA seqDB search
MVKPVNRIITGAHYGLRDWLVQRVTAVIMAVYTGLLIVLVVVYQPEGYEEFKSLFSIQWV
KIASLLCFAGLCWHAWVGVRNVLMDYVHPMFIRLTLQVMCIVALLGYLIWFLDILWG
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacctgtaaaccgtattataaccggggcacattatggtttaagggactggctt
gtgcagcgagtgaccgctgtaataatggcggtctataccggattactgattgtacttgtg
gttgtttaccaacctgaaggttacgaagaatttaaatcgctattttccattcagtgggta
aaaattgcttcattgctttgttttgccggtctatgctggcatgcttgggtgggcgtgcgc
aatgtcctgatggattatgttcacccgatgtttattcgtctgacactgcaagtcatgtgt
atcgtggcattattgggctatctgatatggttcttggatattttgtggggctga

DBGET integrated database retrieval system