KEGG   Nitrosomonas europaea: NE0448
Entry
NE0448            CDS       T00130                                 

Symbol
Rh50
Name
(GenBank) Ammonium transporter family
  KO
K06580  ammonium transporter Rh
Organism
neu  Nitrosomonas europaea
Brite
KEGG Orthology (KO) [BR:neu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:neu02000]
    NE0448 (Rh50)
   04090 CD molecules [BR:neu04090]
    NE0448 (Rh50)
Transporters [BR:neu02000]
 Solute carrier family (SLC)
  SLC42: Rh ammonium transporter
   NE0448 (Rh50)
CD molecules [BR:neu04090]
 Proteins
  NE0448 (Rh50)
SSDB
Motif
Pfam: Ammonium_transp
Other DBs
NCBI-ProteinID: CAD84359
UniProt: Q82X47
Structure
PDB: 
3B9W 3B9Y 3B9Z 3BHS

Position
complement(487992..489269)
AA seq 425 aa
MSKHLCFTAFSSIALFLLCFSSWASAVAPAEINEARLVAQYNYSINILAMLLVGFGFLMV
FVRRYGFSATTGTYLVVATGLPLYILLRANGIFGHALTPHSVDAVIYAEFAVATGLIAMG
AVLGRLRVFQYALLALFIVPVYLLNEWLVLDNASGLTEGFQDSAGSIAIHAFGAYFGLGV
SIALTTAAQRAQPIESDATSDRFSMLGSMVLWLFWPSFATAIVPFEQMPQTIVNTLLALC
GATLATYFLSALFHKGKASIVDMANAALAGGVAIGSVCNIVGPVGAFVIGLLGGAISVVG
FVFIQPMLESKAKTIDTCGVHNLHGLPGLLGGFSAILIVPGIAVAQLTGIGITLALALIG
GVIAGALIKLTGTTKQAYEDSHEFIHLAGPEDEHKAERLVLEAKTEIQGLKNRIDAAVLS
AKSEG
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgagtaaacacctatgtttcactgcgttcagttcaatcgctctgtttctgttgtgtttc
agcagttgggcgagcgcagttgctcctgcagagatcaacgaagcgcgtctggtagcgcaa
tataattactccataaacattctggccatgctgctggtcggtttcggttttttaatggtt
ttcgtacgaaggtacgggtttagcgcaactaccggtacctatctggtcgtagccaccgga
cttccactctatattcttttacgcgcaaacgggattttcgggcacgcattgacgccccac
tccgttgatgcagtaatctatgcggaatttgccgtggctacggggctgattgccatggga
gcagtactcgggcgtttacgggtttttcaatacgcgttactggcattgtttatcgtgccg
gtttatctgctgaatgagtggctggtgctggataatgcttcagggttgactgaaggattc
caggattctgccggatcgatcgctatccatgcttttggtgcatattttggtttgggagtc
tccatcgctctgactactgcggcgcagcgggctcagccgatcgaatcggatgcgacttcg
gatcgcttttcaatgctgggatcaatggtactgtggcttttctggccgagctttgcgact
gcaatcgtaccattcgaacagatgccccaaaccatagtcaacacactgcttgctttatgc
ggcgccacactcgccacctatttcctgagcgcattgtttcacaaaggaaaagcatccata
gtagacatggccaatgcagcacttgctgggggggtagcgatcgggtcagtctgtaacatc
gtcggaccagtaggtgcttttgtgattggtttgctgggtggtgctatttctgtcgtgggt
ttcgtatttattcagcccatgctggaatccaaagccaagacgatagatacctgcggggta
cacaatctgcatggattaccaggattattgggcggatttagtgcgatcctgatagtgcca
ggtattgccgtggctcaattgacgggtatcggtatcacacttgcgctggctttgattggc
ggtgtgattgctggagcactgatcaaactaaccggtacaacgaaacaagcttatgaggac
agtcacgagtttatccatcttgcaggacctgaagatgagcataaagctgaaaggctggta
ttagaggcaaaaactgaaatacagggactgaaaaatcgtattgatgctgctgtattgagt
gccaagtcagaaggatag

DBGET integrated database retrieval system