KEGG   Nitrosomonas europaea: NE0607Help
Entry
NE0607            CDS       T00130                                 

Gene name
gcvT
Definition
(GenBank) Glycine cleavage T-protein (aminomethyl transferase)
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
neu  Nitrosomonas europaea
Pathway
neu00260  Glycine, serine and threonine metabolism
neu00630  Glyoxylate and dicarboxylate metabolism
neu00670  One carbon pool by folate
neu01100  Metabolic pathways
neu01110  Biosynthesis of secondary metabolites
neu01130  Biosynthesis of antibiotics
neu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:neu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NE0607 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NE0607 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NE0607 (gcvT)
Enzymes [BR:neu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     NE0607 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: CAD84518
UniProt: Q82WQ6
Position
660304..661395
Genome map
AA seq 363 aa AA seqDB search
MLKTTPLNAAHRAMNAKMVDFGGWDMPLHYGSQLDEHHSVRRDAGMFDVSHMLTVDIHGE
NVRQFLRGLVANNVDKLTLPGKALYTCMLTPTGGIIDDLIIYFLSESWFRLVVNAGTADK
DIDWITGQSRQLAPALTITPRRDLAMIAVQGPNARTKVWNVIPDSQAISENLKPFQSVML
GDYFIARTGYTGEDGFEITLPAGQAADFWQKLHAAGVAPAGLGARDTLRLEAGMNLYGQD
MDETVNPLESGLAWTVDLKSERDFTGKQTLLETPVNRQLVGLVLLDKGVLRNHQKVITRQ
EGEAGEGEITSGGFSPTLNQSIALARIPAGIAAGEQVHVVVRDKQLAAKVVKYPFVRNGQ
ALV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagacaacccctttgaatgcggcgcaccgggccatgaatgccaaaatggtcgat
tttggcggctgggatatgcccctgcactatggctcccaactggatgagcaccactctgtc
aggcgtgatgccggtatgttcgatgtgtctcatatgttgaccgtcgatattcacggcgaa
aacgtacgccagtttctgcgaggactggtggccaacaatgtcgataaactgaccctcccg
ggcaaagcgctctacacctgcatgctgacccccacaggtggaatcatcgacgatctgatc
atttacttcctgtccgagtcctggttccgtctggtagtcaatgccggtacggctgataag
gatatcgactggatcaccgggcaatcccgccagcttgctcccgctctgaccattaccccg
cgtcgtgatcttgccatgatcgcagtacagggacccaatgcgcgtacgaaagtctggaat
gtcattcctgattcccaggcgatttcagaaaacctgaaaccatttcagtctgtgatgctg
ggtgactatttcatcgcacgtaccggttataccggtgaggatggttttgaaatcacgtta
cccgccggccaggctgctgatttctggcaaaaactgcatgcagcgggtgttgctccggcc
ggactgggtgcacgtgataccctgcgcctggaagcaggtatgaatctttatggccaggat
atggacgagaccgtcaacccgcttgaatcagggcttgcatggactgtggatctgaaaagc
gagcgtgacttcaccggtaaacagacactgctggaaacgccggtcaatcggcagctggtt
ggcctggtattgctggataaaggagtactgcgtaatcatcagaaagtcattacacggcag
gaaggtgaagcaggagaaggagagattaccagtggcgggttttccccaacgttgaaccag
tcgattgcgctggcgcgtattcctgcaggcatcgctgctggtgagcaggtacatgtcgtc
gtgcgggataaacagcttgcggcaaaagtcgtcaaatatccgtttgttcgcaatggtcag
gcactggtctga

DBGET integrated database retrieval system