KEGG   Nitrosomonas europaea: NE0694Help
Entry
NE0694            CDS       T00130                                 

Gene name
trpA
Definition
(GenBank) trpA; tryptophan synthase (alpha chain) protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
neu  Nitrosomonas europaea
Pathway
neu00260  Glycine, serine and threonine metabolism
neu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
neu01100  Metabolic pathways
neu01110  Biosynthesis of secondary metabolites
neu01130  Biosynthesis of antibiotics
neu01230  Biosynthesis of amino acids
Module
neu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NE0694 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NE0694 (trpA)
Enzymes [BR:neu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NE0694 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB Ribul_P_3_epim Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: CAD84605
UniProt: Q82WI1
Position
753980..754807
Genome map
AA seq 275 aa AA seqDB search
MNRIQSVFSQLKSQNRAALIPFITAGDPDATTTVALMHRLTQAGVDLIELGVPFSDPMAD
GPTIQRSSERALKHHISLKDVFSMVAEFRKTNQSTPVVLMGYANPIEAMGYKDFVQTAGH
AGVDGVLVVDYPPEECTEWVRYLKEQNIDPIFLLSPTTPESRIRRVAELARGYVYYVSLK
GVTGASHLDLHEVGDKLSQLRSYINIPIGVGFGIRDEQTARRIAEQADAVVIGSRIVEEI
EHSPAADLLANVGALVESLRRAIDAKSDHSSITEK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtatccaatctgtcttttcccagctcaaatcacagaatagagctgcgctcatt
cccttcatcacggcgggtgatcctgacgcaactacgacagtggcgttgatgcaccggttg
acgcaggccggagtggatctgatcgaactgggagtcccgttttctgatcccatggcggac
gggccaaccatacagcgctcttcagagcgtgcattgaaacatcacatcagtctgaaagat
gtattttccatggtggccgagttcagaaaaaccaatcagagtacaccggtggtcctcatg
ggatatgccaacccgatcgaggccatgggctataaagattttgtgcaaacagccggccat
gccggagtcgatggtgttctggtcgtcgattatccgccggaagaatgtactgaatgggtg
cgctatttgaaagagcagaacatcgatccgatttttctgttatctcccacgacacctgag
tcacgcatcaggcgggttgcggagcttgccagagggtacgtctattatgtttctctgaag
ggagttacgggcgcttcacatcttgatttgcatgaggttggcgacaaactgtcgcagctt
cgttcgtacatcaacattccgattggagtaggtttcggtatacgagatgaacaaacggca
cggcgtattgcagaacaggctgatgcggtagtcataggcagccgcatcgtggaagaaatc
gaacactctccagcggcggatctgctggcgaatgtgggagccctggtagagtctttgcgg
cgtgcaatcgacgcaaaatccgatcattcttctattacggagaagtga

DBGET integrated database retrieval system