KEGG   Nitrosomonas europaea: NE1030
Entry
NE1030            CDS       T00130                                 
Name
(GenBank) iron transport system permease protein
  KO
K02011  iron(III) transport system permease protein
Organism
neu  Nitrosomonas europaea
Pathway
neu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:neu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NE1030
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:neu02000]
    NE1030
Transporters [BR:neu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    NE1030
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: CAD84941
UniProt: Q82VN6
Position
1117425..1118984
AA seq 519 aa
MVLVPVCVVFASFLSPDDEIWQHLISTTLPSLLTNTLWLSLGVIVGTSLLGVSLAWFTSV
YRFPGYRFFSWALFLPLAIPAYVIAFVALGTFDYTGPVQTSLRHWFNSDLLWFPDIRSGP
GVAIVMTLAFYPYVYLLSRDAFLTQGKRLLEVAQSLGFTRQQGFFRVVLPMARPWIVAGI
MLALMETLADFGTVSIFNYDTFTTAIYKTWFGMFSLSTASQLASLLILIVLVIIMTEQRF
RLRMRFSESRKSARVERIPLTGWQAMAVTGFAGTVLFFAFALPIIQLGIWAMDALTIGLD
QRYLEFAWHSILLSVLAALITCLVAAMLAYAARLHSDGYTRFAIRLTTVGYALPGAVLAV
GIFIPMAWLDNLLSDWIENISGVETGLLIQGTLTVMLVAYMTRFLAVSYFPLESALQRVT
RSIDEAAAGFGVTGWSMLRMIYFPMLKSSLFTAATLVFVDVMKEMPITLMTRPFDWDTLA
VRIFSLTSEGQWDQAALPALTLILTGLIPIILLIRHSET
NT seq 1560 nt   +upstreamnt  +downstreamnt
gtggtgcttgtaccggtatgcgtggtatttgcctcatttctctcgccggatgatgagatc
tggcaacatctgatctctaccacgctaccgagtctgctgacgaacaccctatggctttca
ctgggagtcatagtgggaacctctctcctgggagtcagtctcgcctggtttacttcggtt
tacaggtttcccgggtatcgttttttttcctgggcattattcctgccactggcaattcct
gcctatgtaatcgcctttgtagcgctgggtacgtttgactataccgggccggtacaaacc
agtttgcgtcattggttcaactctgatctgctctggtttcccgatatacgtagcgggccg
ggtgtggcaatcgtaatgacactcgctttttacccctatgtctatttgctctcacgcgat
gcctttctgacacagggaaaacgtttgctggaagttgcccaatctctgggcttcactcgt
cagcaaggttttttcagagtagtactgccgatggcgcgtccctggatcgttgccggcatc
atgctggctctgatggaaacgctggctgattttggtacagtctccattttcaactacgat
acattcaccaccgcgatttataaaacctggttcggcatgttttccctgtcaactgcttcg
cagcttgcttcactgcttattctgattgtacttgtcatcatcatgacagaacaacggttc
cgcctgcggatgcgtttttctgaaagcaggaaaagtgcacgggttgaacgtattccgctc
accggctggcaggcaatggcagtaaccggttttgccggtacagtattgttttttgctttt
gcattacccattatacagttgggtatatgggccatggatgcgctgaccatcggcctggat
cagcgttatctcgagttcgcctggcattctatcctgctttctgtactggctgccttgata
acctgtctggtagcggccatgctggcatatgccgcacgcctccattcagatggttatacg
cgttttgccattcgtctcaccacagttggctatgctttaccgggtgcagtactggcagtg
ggaatattcattccgatggcgtggctggataatctgctgagtgactggatcgaaaatatt
tccggggttgaaaccggattactgatccagggaacgctcacggtcatgctggttgcgtat
atgacccgttttctcgcagtcagttactttcctctggaaagcgcgctgcagcgcgtaaca
cgcagcatcgacgaggctgccgccggttttggtgttaccggctggtcaatgttgagaatg
atctattttccaatgttgaaaagcagcctgtttacggcagcaacactggtattcgtggat
gtcatgaaggaaatgcccattacgctgatgacccggcctttcgactgggataccctggcg
gtgcgcattttctcattaacctctgaaggacaatgggatcaagcggcattgcctgcattg
acactgattctgaccggactgattccaatcattcttctgatacgccattccgaaacctga

DBGET integrated database retrieval system