KEGG   Nitrosomonas europaea: NE1031
Entry
NE1031            CDS       T00130                                 
Name
(GenBank) putative iron transport system ATP-binding protein
  KO
K02010  iron(III) transport system ATP-binding protein [EC:7.2.2.7]
Organism
neu  Nitrosomonas europaea
Pathway
neu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:neu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NE1031
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:neu02000]
    NE1031
Enzymes [BR:neu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.7  ABC-type Fe3+ transporter
     NE1031
Transporters [BR:neu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    NE1031
SSDB
Motif
Pfam: ABC_tran TOBE_2 AAA_21 SMC_N AAA_22 AAA_23 AAA_16 AAA Rad17 RsgA_GTPase AAA_25 ABC_ATPase AAA_29 AAA_5 SAM_decarbox
Other DBs
NCBI-ProteinID: CAD84942
UniProt: Q82VN5
Position
1118992..1120062
AA seq 356 aa
MSTLLELDRISHAYGAQVIVNELSFELEKGEIGCLLGPSGCGKTTVLRCIAGFEPIVSGE
IRLNEISVSRAGFVLPPEQRRVGMVFQEYALFPHLTVTANVGFGLHRSTKAERAHRVAEL
LQITGLMEVANRYPHELSGGQQQRVALVRALAPYPDLILLDEPFSNLDVSLREYLGQEIR
ELLKKLNITAILVTHDQAEAFAVADKIGVMHAGKMMQWGSAHELYHHPANRFIADFIGQG
TLIPGKVTHSDKVETELGTLAGNIYHPGHSSREIAGSQVDVLIRPDDVIHDNDSSLRAVV
VHKAFRGAQFLYTLRLASGQSVLSLISSHHDHAIGEKIGIRPQTDHIVVFDRVNSQ
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgagtacattgctggaacttgacagaatcagccacgcctatggcgcacaggttatcgtg
aatgaactgtcattcgagctggaaaaaggcgagatcggttgcctgcttggtccaagcggt
tgcggcaaaacgactgttttgcgctgtatcgccgggttcgagccgattgtatccggtgaa
atacggttgaatgaaatttctgtcagccgtgccggattcgttctgccacccgagcaacgg
cgggtaggtatggtatttcaggaatatgcgctgttcccgcacctgactgtaaccgccaat
gtcgggtttggtctgcaccgcagcaccaaagcagagcgggctcatcgggttgccgaattg
ctgcagatcaccggtttgatggaagtagccaatcgttacccgcatgaattatctggcggt
cagcagcagcgtgtggcattggtgcgggcactggccccctatcctgacctgatattgctg
gatgaaccgttctccaatctcgatgtaagtttgcgtgaatacctaggccaggaaatacgc
gagctgctcaagaaactgaacattactgcgattctggttacgcacgaccaggcggaggct
tttgccgttgcagacaaaataggtgtgatgcatgctggaaaaatgatgcagtggggcagc
gcacatgagctctaccatcatcccgcaaatcgtttcatcgcggatttcatcgggcagggc
acactgattcctggaaaagtcacacactccgataaagtggaaaccgagttgggtaccctg
gccggaaacatttatcacccgggccattcatcccgtgaaattgcgggcagccaggtggat
gtactgatacgccctgatgatgttattcatgataacgatagttcgctgcgggctgtcgta
gtacacaaagcgttccgcggtgcacaatttctttatacgttacgccttgccagcggacag
agtgtgctgtcactgatttccagccaccacgatcatgccattggtgagaaaattggcatc
aggccacaaactgaccatattgtggtatttgaccgggttaacagtcagtaa

DBGET integrated database retrieval system