KEGG   Nitrosomonas europaea: NE1047Help
Entry
NE1047            CDS       T00130                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase, cytochrome b subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
neu  Nitrosomonas europaea
Pathway
neu00020  Citrate cycle (TCA cycle)
neu00190  Oxidative phosphorylation
neu00650  Butanoate metabolism
neu01100  Metabolic pathways
neu01110  Biosynthesis of secondary metabolites
neu01120  Microbial metabolism in diverse environments
neu01130  Biosynthesis of antibiotics
neu01200  Carbon metabolism
Module
neu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
neu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
neu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NE1047 (sdhD)
   00650 Butanoate metabolism
    NE1047 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    NE1047 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CTV_P6
Motif
Other DBs
NCBI-ProteinID: CAD84958
UniProt: Q82VM6
Position
1133785..1134138
Genome map
AA seq 117 aa AA seqDB search
MVKPVHRVVTGAHYGLKDWLVQRITAVLMAAYTGLLIILITVYQPESHEEFKALFSIQWM
KIASLLFFAGLCWHAWVGVRNVLMDYVHPMPVRLTLQITCIVALLGYLIWFLDILWG
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaccggttcatcgtgtcgtaaccggagcgcattacggtctgaaagactggttg
gtgcagcgtatcactgctgttctgatggcagcctataccgggttgctgatcatactcata
acagtttatcaaccggaaagccatgaagagttcaaagcattattctccattcagtggatg
aaaattgcttcgttacttttttttgccggcttatgttggcacgcttgggtaggtgtacgt
aatgtcctgatggattatgtccatccgatgcctgtccgcctgacactgcaaataacatgt
atcgttgcattactgggttacctgatatggttcctggatattctgtggggctga

DBGET integrated database retrieval system