KEGG   Nitrosomonas europaea: NE1097
Entry
NE1097            CDS       T00130                                 
Name
(GenBank) TonB-dependent receptor protein
  KO
K02014  iron complex outermembrane recepter protein
Organism
neu  Nitrosomonas europaea
Brite
KEGG Orthology (KO) [BR:neu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:neu02000]
    NE1097
Transporters [BR:neu02000]
 Other transporters
  Pores ion channels [TC:1]
   NE1097
SSDB
Motif
Pfam: TonB_dep_Rec Plug STN
Other DBs
NCBI-ProteinID: CAD85008
UniProt: Q82VI7
Position
complement(1189452..1191926)
AA seq 824 aa
MLFASLVHPIRFPLDPVRLLSLLLPIIVVTALPAQAAENALDTPAAARKHYDIPAGPLGR
ALSHFAMVAGIALSFDPALTEGRTSPALTGNFSVDEGFNRLLAGSGLELIRNDDGSYTLH
RAPVKATQAGVTALPVVTVSTSTENADDTGYVTQRSSSSTKTDTPLIEVPQSISVITRRE
LDARLVQNISQAVSYTPGVLTEMYGPVMRDDYFNIRGFDAPQFLDGLGLWGVNYANLRIE
PYGMESIEVLKGPSSTLYGQSSPGGLVAMVSKRPTAVPVREAFITGGSFGRIQGGLDLGG
PIDSNGQFLYRLTGLVRNSDTQINHAHEDRYFIAPSISWRPTSDTTFTLLSHFQKDDAGN
TLQFLPPEGSLLENPNGKIPTSRFIGEPGFDKYNREQYTIGYAFDHRFNESWGVQQNLRY
ANVSSNYPTTFYLDFLRDDDGVPLDFRTIDRLAALYQDKAGTFTMDTRVQGIFDTAMLRH
NLLLGIDYRYLSGSNRRGFSEDMLLLDIYDPVYGEPFGLPVIDYISKQQRDQIGLYAQDQ
IKYDRWILTLGVRYDFSSAHTRNHDLFFDERSSTRQNDRAFTYRTGINYLFDNGIAPYAS
YAESFQPIAGTDFFGSPFKPTTGRQYEAGIKYQPVNHNALLTVAAYHLTQKNVVTPDLTP
GHFGYNVQTGEARVRGVEVEGKARLMNDLNLIVAYSFADSKVTESNNPDELGNRLSLTPR
HQTSAWLDYTFRGNQLAGLGLAGGVRHIGSNFGDLVNNLKAPVYTLFDAAVRYDMKHLHS
VLQGASLSVNVNNLFDNKYIATCADMACFYGNRRTVYATLRYKW
NT seq 2475 nt   +upstreamnt  +downstreamnt
atgctgtttgcctccctcgttcatcccatccgattcccattggacccggtaaggctattg
tcgctgttgctaccaatcattgtcgtcacagcattacctgcccaggcggctgaaaatgca
ctggatacgcctgctgctgcccgaaagcactatgacattccggcaggcccgctgggacgg
gcactctcacatttcgcaatggttgctggtatcgcactttcgtttgatccggcactgaca
gaaggacgtaccagcccggcgctgacaggaaatttttcagtagatgaaggattcaatcgg
ctgctggcaggtagtggtctggaactgatacgcaatgatgatggcagctatacactgcat
cgggcacccgtcaaagcgacccaggcaggggtaaccgcattaccggtcgtgactgtctcg
accagtacggaaaatgctgatgatactggctatgtcacgcagcgcagcagttcgagcacg
aaaacagatacaccgttgatcgaggtaccacagtcgatttcagtgattacgcgccgtgag
ctcgatgcgcggctggtgcagaatatcagccaggcagtttcctatacgcccggtgtgctg
acagaaatgtacggacctgtaatgcgggatgactatttcaatatccggggattcgatgcg
ccgcaatttctcgacgggctgggtttatggggggtgaattatgccaacctccgtatcgaa
ccgtatggaatggaaagcatcgaggtgctgaaagggccttcttctaccctgtatggccag
agttcacccggcgggctggttgctatggtaagtaagcgtccaacggccgtaccggtacgt
gaagcgttcattaccggcggaagctttggccgtattcagggcggactcgatctcggcggg
ccgatcgacagcaacggtcagtttctttatcggctcacaggactggtgcgcaatagtgat
acgcagatcaaccacgctcatgaagatcgttacttcatcgcaccgagcattagctggcgg
ccaactagcgataccacttttacgctattgagtcattttcaaaaggatgatgctggcaat
acactccagtttctgcccccggaaggctcactgctggaaaatccgaacggcaaaatacca
accagccgctttatcggagaacccggtttcgataaatacaatagagagcaatatacgatc
ggttacgcgtttgatcatcgtttcaatgaatcctggggagtgcaacagaatttacgttat
gccaatgtatccagcaattaccccactacgttttatctcgattttctgagagatgatgat
ggggtaccactggatttccggacgattgatcggctggcggccctttatcaggacaaggcg
ggtacgttcacgatggatacccgggtacagggtatatttgatactgccatgctccggcat
aacctgctgctgggtatagattaccgctatctttccggcagtaaccgccgtggtttttcc
gaagacatgctgcttctggatatctacgatccggtttatggtgagccgtttggtttgccg
gtcattgattacatcagcaaacagcagcgtgaccagatcggtctctatgcccaggatcag
atcaaatatgatcgatggatactcacgctgggtgtccgttacgatttttccagtgcacat
acgcgaaatcatgatttgttctttgatgagagaagcagcacccggcagaatgatcgcgct
ttcacttatcggacaggaataaactatctgttcgacaatggcatcgcaccatacgcgagt
tatgccgaatcttttcaaccgattgcaggaaccgattttttcggttcaccattcaaaccg
actaccggtcggcaatatgaggcgggtatcaagtaccagccggtcaaccataatgccttg
ctgactgtcgcggcttatcatttgacacagaagaatgtcgtcactcctgatctcacgccg
gggcatttcggttataacgtgcaaaccggtgaagcgcgtgtacgaggagtagaggtggaa
ggtaaagcgcgcctcatgaacgatctcaatctcatcgttgcgtattcttttgctgattcg
aaggtgaccgagagtaacaatccggacgagcttggcaaccggttatcactgactcccagg
catcagacttctgcctggctggactacacttttcgaggtaatcaactcgccgggttgggt
cttgccggcggggtgcgacatatcggctcgaacttcggtgatctcgtcaataacctgaag
gcgcctgtctacaccttgttcgatgcggcggtacgctacgatatgaagcatctgcacagt
gtgctgcagggtgccagtctgagcgtgaatgtgaataatctgttcgataacaaatacatt
gccacctgcgcggatatggcctgtttctatggcaatcgtcggacggtttacgcgacgctg
cgttataaatggtga

DBGET integrated database retrieval system