KEGG   Nitrosomonas europaea: NE1290Help
Entry
NE1290            CDS       T00130                                 

Gene name
proB
Definition
(GenBank) Aspartokinase superfamily:Glutamate 5-kinase:PUA domain
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
neu  Nitrosomonas europaea
Pathway
neu00330  Arginine and proline metabolism
neu00332  Carbapenem biosynthesis
neu01100  Metabolic pathways
neu01130  Biosynthesis of antibiotics
neu01230  Biosynthesis of amino acids
Module
neu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NE1290 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NE1290 (proB)
Enzymes [BR:neu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NE1290 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CAD85201
UniProt: Q820M4
Position
complement(1410232..1411353)
Genome map
AA seq 373 aa AA seqDB search
MTQSILQSARRIVVKVGSSLVTNEGHGLDRCALGGWAGQISRLRQMGKEVVLVSSGAVAE
GMQRLGWKMRPAALYELQAAAAVGQMGLAQAYADCFSEYELQTAQILLTHDDLSSRKRYL
NARSTILTLLNLGIIPVINENDTVVSDEIRFGDNDNLAALVANLIEAEVLVILTDQEGLF
TGDPRKNTDARLIPEVSVSDPDIEVMAGGAGSSIGRGGMQSKVMAARRAARSGAHTVIAS
GRAKDVLVRLAGGEAIGTILLADMPVKVARKLWLADHLQVRGSVVLDDGASRALLSGGKS
LLPIGVVEIKGEFERGEAISCLDASGREIARGLINYDARESRKIMRRPTSQIEAVLGYVD
EYELIHRDNLVIL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatcgattctgcaatccgcccgccggatagtcgtaaaagttggcagcagcctg
gtgacgaatgaaggacacggtcttgatcgctgtgcactgggaggctgggccggacagatt
tcccggctcagacagatgggcaaggaagtcgtgctggtttcatccggcgccgttgccgag
ggtatgcagcgtctgggctggaaaatgcgtcctgcggcgctttatgagctgcaggctgcc
gcggcagtggggcagatggggcttgcccaggcctatgccgattgtttcagtgaatacgaa
ttacagacggctcagattctgctgacgcatgatgatctgtcgagtcgtaaacgctatctg
aatgcccgttcgaccattcttacgctgctgaatctgggtatcattccggtcatcaatgag
aacgatactgtggtttccgatgaaatccggtttggtgacaacgataatctggctgcactg
gttgccaatctgatcgaagccgaagtgctggtgatcctgactgaccaggaaggtcttttt
accggcgatccgcgcaaaaataccgatgccagactgatcccggaagtcagcgtcagcgat
ccggatatcgaagtcatggccggtggggcgggcagcagcatcggacgcggtggtatgcaa
agcaaggtaatggctgccaggcgtgctgctcgcagcggtgcgcatacggtgatcgcttca
ggcagggcgaaggatgtgctggttcgtctggcaggtggagaggctatcggaaccattctg
ctggcggatatgccagtgaaggtggcgcgcaagttgtggctggccgatcatctccaggta
cgggggagtgtagtgctggacgatggggccagcagagcattgctgtctggaggtaaaagt
ctgctgcccatcggggtggtggagataaagggtgaatttgaacgtggagaagccatatcc
tgcctcgatgccagcggccgtgaaatcgctcgtggcctgatcaattacgatgctcgtgaa
tcacgcaagatcatgcgtcgtcctaccagccagattgaagctgtgctgggttatgtggat
gaatatgaacttattcacagagataacctggttattctgtaa

DBGET integrated database retrieval system