KEGG   Nitrosomonas europaea: NE2111Help
Entry
NE2111            CDS       T00130                                 

Definition
(GenBank) hypothetical protein
Organism
neu  Nitrosomonas europaea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhdYeFM_antitox
Motif
Other DBs
NCBI-ProteinID: CAD86022
UniProt: Q82T22
Structure
PDB: 

Position
2296116..2296373
Genome map
AA seq 85 aa AA seqDB search
MHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAARPSLKQLLL
SDSARTEMLVPERGKARRRQVEPLR
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtctggcctgttcaagatgccaaggctcgctttagcgagtttctggacgcctgc
ataaccgaaggaccccagattgtttcccgccggggcgccgaagaagcggtattggtgccc
attggagaatggcggcgcctgcaagcggctgcacgcccctcgcttaagcaattgttgctc
tctgactcagcccgcactgagatgctcgttcccgagcgaggcaaagcccgccgacgccag
gttgaacccctgcggtga

DBGET integrated database retrieval system