KEGG   Nitrosomonas europaea: NE2262Help
Entry
NE2262            CDS       T00130                                 

Gene name
bktB
Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
neu  Nitrosomonas europaea
Pathway
neu00071  Fatty acid degradation
neu00280  Valine, leucine and isoleucine degradation
neu00310  Lysine degradation
neu00362  Benzoate degradation
neu00380  Tryptophan metabolism
neu00620  Pyruvate metabolism
neu00630  Glyoxylate and dicarboxylate metabolism
neu00640  Propanoate metabolism
neu00650  Butanoate metabolism
neu00900  Terpenoid backbone biosynthesis
neu01100  Metabolic pathways
neu01110  Biosynthesis of secondary metabolites
neu01120  Microbial metabolism in diverse environments
neu01130  Biosynthesis of antibiotics
neu01200  Carbon metabolism
neu01212  Fatty acid metabolism
neu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:neu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NE2262 (bktB)
   00630 Glyoxylate and dicarboxylate metabolism
    NE2262 (bktB)
   00640 Propanoate metabolism
    NE2262 (bktB)
   00650 Butanoate metabolism
    NE2262 (bktB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NE2262 (bktB)
   00072 Synthesis and degradation of ketone bodies
    NE2262 (bktB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NE2262 (bktB)
   00310 Lysine degradation
    NE2262 (bktB)
   00380 Tryptophan metabolism
    NE2262 (bktB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NE2262 (bktB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NE2262 (bktB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NE2262 (bktB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:neu04147]
    NE2262 (bktB)
Enzymes [BR:neu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NE2262 (bktB)
Exosome [BR:neu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NE2262 (bktB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAD86174
UniProt: Q82SP5
Position
2450711..2451889
Genome map
AA seq 392 aa AA seqDB search
MRNVVVLSGARTAIGDYGGALKDLAPATLAAITVREAITRASVDSDKIGHLVAGHVIPTE
AQDMYLARVAALEAGLPQSVAALTLNRVCGSGLQAIISAAQAVMLGDTEVAIAAGAESMS
RGGYLLPALRWGQRMQDSTAVDMMVGALTDPFDRVHMGITAENIAERWSITREQQDRFAL
ESHRRAIHAVHNGYFREQIVPVEVSTREGVAMFDTDQHPRDNISMETLGKLRPVFREDGT
VTAGNASGINDGAAALVLMEERAAERNHHQPMARLVAYGHAGVNPRYMGIGPVPAVKQAL
NRAGLDLAEMDVIESNEAFAVQACAVARELNFDPDKVNPNGGAVALGHPIGASGCILAIK
AIYELQRINGRYALVTLCIGGGQGIAAIFEKL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatgtcgtcgttctcagtggcgcaagaaccgcgatcggtgattacggtggcgcg
ctgaaggatctggcgcctgccacgctggcagccataacggtcagggaagcaatcactcgc
gccagcgtcgattctgacaagattgggcacctcgtcgccgggcacgttatccccactgaa
gcgcaggatatgtatctggcgcgcgtggcggcgctggaagccggcctgccgcagagtgta
gcggcgcttaccctgaatcgtgtttgcggcagtggattgcaggccatcatttcagctgcg
caggccgtgatgctgggagatacggaagtggctatcgctgctggagccgagtcgatgagt
cgaggaggatatcttcttcccgcactgcgctggggacaacgtatgcaagacagtaccgca
gtcgatatgatggtgggcgcactgaccgatccgtttgaccgggtacacatgggaatcact
gcagaaaacattgctgaaagatggagcattacccgcgagcagcaggatcgattcgcactg
gaaagtcatcggcgcgccattcacgctgttcacaacggctatttccgcgagcagatcgta
ccggttgaagtttccacccgcgaaggtgtagcgatgttcgatacagaccagcacccgcgc
gacaacatcagtatggaaacgctgggtaaactgcgccctgttttccgggaagacggcaca
gtcacggccggtaacgcatccggcatcaatgatggtgctgccgcactggtgctgatggag
gaacgcgcagccgaacggaatcatcatcaaccgatggcacgtctggtcgcttatggccac
gccggagtcaatccgcgctacatgggaatcggccccgtgcccgcagtcaaacaggcactg
aaccgggccgggctcgatctggctgagatggatgtcatcgaatccaatgaggcgtttgct
gtccaggcgtgcgcagtcgcccgggaactgaatttcgacccggacaaagtcaatccaaac
gggggcgccgtggcactggggcatcccattggtgcatccggttgtatactggcaatcaaa
gccatttacgagctgcagcgtataaacggccgctatgcactggtcactttgtgcatcggt
ggcggacagggaatcgccgcaatttttgaaaaactctga

DBGET integrated database retrieval system