KEGG   Candidatus Nitrososphaera evergladensis: NTE_02041Help
Entry
NTE_02041         CDS       T03224                                 

Definition
(GenBank) Nucleoside-diphosphate-sugar pyrophosphorylase family protein
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
nev  Candidatus Nitrososphaera evergladensis
Pathway
nev00051  Fructose and mannose metabolism
nev00520  Amino sugar and nucleotide sugar metabolism
nev01100  Metabolic pathways
nev01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nev00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    NTE_02041
   00520 Amino sugar and nucleotide sugar metabolism
    NTE_02041
Enzymes [BR:nev01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     NTE_02041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AIF84098
UniProt: A0A075MSF9
Position
1683341..1684048
Genome map
AA seq 235 aa AA seqDB search
MKAVILAGGLGTRLQPYTFFIPKPMLPLGNKPLLEYTIEWLRNAGGIKEIVICVSYLHRT
IEDYFEDGSRFNVNIDYARAERPLATAGQLKTAEKMLADDTFVCVYGDSVYEFNLRKMLK
MHKESNAFISMALMHYSTKLKYGFIDVEGNDITGWREKPEISGLINIGCYVMEPSFLKAI
PKAGAFGMDDAVRNALAQKKKVKAFEVDGSGFIDIGDKKSYLDAYKQFASRLGKI
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtcattcttgcaggcggccttggaacgaggctccagccgtacacgttcttt
atacccaagccgatgctcccacttggcaacaagccgctcctcgaatacaccatagagtgg
ctaagaaacgccggcggcatcaaagagatcgtgatctgcgtcagctacctccatcggaca
atcgaggattactttgaggacgggagcaggttcaacgtcaacatagactatgcccgcgca
gagagaccccttgcaacagcggggcagctgaaaaccgcggaaaagatgcttgccgacgac
acgtttgtctgcgtctatggcgactcggtatacgagttcaacctgcgcaagatgcttaaa
atgcacaaggaaagcaacgcgtttatttcgatggcgctcatgcactactcgacaaagcta
aagtacggctttatcgacgtcgagggaaacgacataaccggctggcgcgaaaagcccgag
ataagcggcctcatcaacataggatgctacgtcatggaaccgagctttctaaaggcgata
ccaaaggcgggcgcgtttggcatggacgacgctgtcagaaacgcccttgcgcagaaaaag
aaggtcaaggcttttgaggtagacggctcggggttcattgacattggcgacaagaaatcg
taccttgacgcgtacaagcagtttgcaagcaggctgggcaagatataa

DBGET integrated database retrieval system