KEGG   Nocardia farcinica IFM 10152: NFA_17640Help
Entry
NFA_17640         CDS       T00207                                 

Gene name
murD
Definition
(GenBank) putative UDP-N-acetylmuramoylalanine-D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
nfa00471  D-Glutamine and D-glutamate metabolism
nfa00550  Peptidoglycan biosynthesis
nfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    NFA_17640 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NFA_17640 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nfa01011]
    NFA_17640 (murD)
Enzymes [BR:nfa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     NFA_17640 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:nfa01011]
 Precursor biosynthesis
  Amino acid ligase
   NFA_17640 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C TrkA_N DUF3995
Motif
Other DBs
NCBI-ProteinID: BAD56610
NIH_Japan: nfa17640
UniProt: Q5YYY1
Position
1919747..1921240
Genome map
AA seq 497 aa AA seqDB search
MIRMVEHSPRALRSPGPMLEFLRGRDVLVAGWGISGRSLVEPLRDIGAHPVVTDSGAKAL
AEAAELGLEVATSVELESADLSRFALVITSPGWRPDSPVLVSAVTEGIPVWGDVEFAWWV
DQARIYGPVRKWLVVTGTNGKTTTTQMTHAILRAAGIASVACGNIGLPILDALRRNPGPQ
VLAVELSSFQLHWAPSVRPEAGVVLNVAEDHLDWHGGLDAYAAAKARALVGRIGVVGLDD
PVAAALARRSKARRTVGFRVGVPADGELGVVDGKLLDRAFTKAAILAEVGDISPPGPAGV
ADALAAAALTRAIDVAPQFVKEGLQEHKVGPHRAAFVREVAGVEFIDDSKATNPHAARSS
ILAHPHVVWIAGGRLKGAAVEDLVEEVADRLVAAVLIGVDAPVIAAALARHAPEVPVVEV
RAGDDAVMADDPLRPDEADAVMAAAVRTAAGYARAGDTVLLAPAAASLDMFADYTHRGRS
FADAVHALEDGDIGRQP
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaggatggtcgaacattctccgcgggccctgcgatcaccggggcccatgctcgaa
ttcctgcgcgggcgtgacgtgctcgtcgccggctggggcatctccgggcgctcgctggtc
gagccgttgcgcgacatcggcgcgcatcccgtcgtcaccgacagcggcgcgaaggcgctg
gccgaggccgccgaactcggcctggaggtggccacctcggtcgagctcgagagcgccgac
ctgagccggttcgcgctggtcatcaccagcccgggctggcggccggactcgccggtgttg
gtctcggcggtcaccgagggcatcccggtctggggcgatgtcgagttcgcctggtgggtg
gaccaggcccgcatctacgggccggtgcgcaagtggctggtcgtcaccggcaccaacggc
aagaccaccaccactcagatgacgcacgccatcctgcgcgcggcggggatcgcgagcgtc
gcctgcggcaacatcgggctgccgatcctggacgcgctgcgccgcaaccccggtccgcag
gtgctggcggtggaactgtcgagcttccagctgcactgggctccctcggtacgcccggag
gcgggcgtggtgctcaacgtcgccgaggaccatctggactggcacggcgggctggacgcc
tacgccgcggccaaggccagggcgctggtcgggcggatcggcgtggtcggcctggacgat
ccggtggccgcggcgctggcccggcgctccaaggcccggcgcacggtcggcttccgggtc
ggtgtgcccgccgacggcgagctgggcgtggtggacggcaaactgctcgaccgcgcgttc
accaaggccgcgatcctggccgaggtgggcgacatcagcccgcccgggcccgccggtgtc
gccgacgcgctggccgccgccgcgctgaccagggccatcgacgtcgcgccgcagttcgtc
aaggagggcctgcaggagcacaaggtgggcccgcaccgggcggcgttcgtgcgggaggtg
gccggtgtcgagttcatcgacgactccaaggccaccaacccgcacgcggcccgctcctcg
atcctggcccacccgcacgtggtctggatcgcgggcggccggctcaagggcgcggccgtg
gaggacctggtggaggaggtcgccgaccggctggtcgccgccgtgctgatcggcgtcgac
gcgccggtgatcgcggccgcgttggcgcgacacgcgcccgaggtccccgtggtcgaggtg
cgcgcgggtgacgatgcagtgatggccgacgacccgctccgccccgacgaggccgacgcc
gtgatggcggcggccgtgcgcacggccgccgggtacgcccgcgcgggcgacaccgtgctg
ctcgcgcccgcggccgcctcgctggacatgttcgccgattacacccaccgtggacgcagc
ttcgccgacgcggtgcacgcgctggaagacggtgacatcgggcggcagccgtga

DBGET integrated database retrieval system