KEGG   Nocardia farcinica IFM 10152: NFA_18470Help
Entry
NFA_18470         CDS       T00207                                 

Gene name
hisB
Definition
(GenBank) putative imidazoleglycerol-phosphate dehydratase
  KO
K01693  imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
nfa00340  Histidine metabolism
nfa01100  Metabolic pathways
nfa01110  Biosynthesis of secondary metabolites
nfa01230  Biosynthesis of amino acids
Module
nfa_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:nfa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    NFA_18470 (hisB)
Enzymes [BR:nfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     NFA_18470 (hisB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPD
Motif
Other DBs
NCBI-ProteinID: BAD56693
NIH_Japan: nfa18470
UniProt: Q5YYP8
Position
2021341..2021991
Genome map
AA seq 216 aa AA seqDB search
MTDTTLRHRTARVERVTKESSIVVELDLDGTGRTDISTGVPFYDHMLTALGAHASFDLSV
RAEGDIQIEAHHTVEDTAIVFGQALGKALGDKAGIRRFGDAFIPMDETLAHAAVDVSGRP
YCVHTGEPEHLLHAVIPGSPVRGTGEPGAPYSTVLNRHVFESIALNARIALHVRVLYGRD
QHHVTEAEFKAVARALRAAVEFDPRVSGVPSTKGTL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccaccctgcgccaccggaccgcgcgcgtcgagcgcgtcaccaaggagtcc
agcatcgtcgtcgaactcgacctcgacggcaccgggcgcaccgacatcagcaccggtgtg
ccgttctacgaccacatgctcaccgcgctcggcgcgcacgccagtttcgacctgagcgtg
cgggccgagggcgacatccagatcgaggcacaccacaccgtcgaggacaccgcgatcgtg
ttcggccaggcactgggcaaggccctgggcgacaaggcgggaatccggcgcttcggcgac
gcgttcattcccatggacgagacgctcgcgcacgccgcggtcgacgtgtccggccgcccc
tactgcgtgcacaccggggagccggagcacctgctgcacgcggtgatccccggttcgccg
gtgcgcggcaccggcgagcccggtgcgccgtactcgacggtgctcaaccgccacgtgttc
gagtcgatcgccctcaacgcccgcatcgccctgcacgtgcgggtgctctacggacgcgac
cagcaccacgtcaccgaggccgagttcaaggcggtggcccgcgcgctgcgcgccgccgtc
gagttcgacccgcgggtcagcggtgtgccgtcgacgaagggaacgttgtga

DBGET integrated database retrieval system