KEGG   Nocardia farcinica IFM 10152: NFA_31340Help
Entry
NFA_31340         CDS       T00207                                 

Gene name
aph(2'')
Definition
(GenBank) aminoglycoside 2''-O-phophotransferase
  KO
K17910  aminoglycoside 2''-phosphotransferase [EC:2.7.1.190]
Organism
nfa  Nocardia farcinica IFM 10152
Brite
KEGG Orthology (KO) [BR:nfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:nfa01504]
    NFA_31340 (aph(2''))
Enzymes [BR:nfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     NFA_31340 (aph(2''))
Antimicrobial resistance genes [BR:nfa01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    NFA_31340 (aph(2''))
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH hemP
Motif
Other DBs
NCBI-ProteinID: BAD57981
NIH_Japan: nfa31340
UniProt: Q5YV10
Position
3328243..3329172
Genome map
AA seq 309 aa AA seqDB search
MDTSATVTLPDDWEPRLRAALRATPVAAATAGRLRVLGAGLDSVALLLEHDGERYVLRCP
KGTDGAAGIARESRVLPELAPTLALPIPQFLCTAPNPLGPGEFCIYPAVPGESLTEDQWV
ARGLAESDAAAGQVARFLDQLHAFPVDRARQLGVENRVMRDEFTDYLTEADSAVLPRLAP
PDAATLRAAWTAYLADDANFAYTPTLIHADVSPDHLLVTGQQVTGVIDFGDLQIADPDYD
LLYLWTDAGPDFVERVQHHRGRTVDARLRAKLRFWTYADSVIDILHALEHDLPDLLDESM
DHLVEALRA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtggacacgagcgcgaccgtcaccctgcccgacgattgggaaccccgactacgggcggca
ctgcgcgccacccccgtcgccgccgccaccgccggccggttgcgggtgctgggcgcgggc
ctcgacagcgtcgccctcctgctcgagcacgacggggagcgatacgtgctgcgctgcccg
aagggaaccgacggcgccgcgggcatcgcgcgcgaatcccgcgtcctgcccgaactcgcg
cccaccctggcgctgccgatcccgcagttcctctgcaccgcaccgaatccgctcggcccc
ggcgagttctgcatctacccggccgtccccggcgaatcgctcaccgaggaccagtgggtc
gcgcgcgggctggccgaatccgacgccgccgccggtcaggtcgcgcggttcctcgaccaa
ctgcacgcctttccggtcgaccgggcccggcagctcggcgtcgaaaaccgggttatgcgc
gacgaattcaccgactacctgaccgaggccgacagcgcggtgctgccccgcctcgcccca
ccggacgcggcgaccctgcgcgccgcctggaccgcctacctcgccgacgacgccaacttc
gcctacacccccaccctgatccacgccgacgtgagtcccgatcacctgctggtcaccggg
cagcaggtgaccggcgtcatcgatttcggcgacctccagatcgccgaccccgactacgac
ctgctctatctgtggaccgacgcgggacccgacttcgtcgagcgcgtccagcaccaccgc
ggccgaaccgtggacgcgcggctgcgcgccaaactccgcttctggacctacgccgattcg
gtgatcgacatcctgcacgcgctcgagcacgacctgcccgatctgctcgacgagagcatg
gaccacctcgtcgaggccctgcgcgcctga

DBGET integrated database retrieval system